TkA04G002550 | RubberDandelionOmics

Gene overview

TkA04G002550

Reference: TK1151 Chr: Chr04 Coordinates: 658512-659504 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · TkA04G002550|TK1151|cDNA

ATGGATCTTCTCAAAAATTCATTCGGCTCCACAGTGCTCGCTATCAAAAGAATCGAAGGTTACGAGTTGAAGTATGGAACCCTAATGATATGCACAGAGAAGAAAACGATATTGTCTGTTGAAGACATCATCGCTTTGATCGGAAACAGGTGCGATGGAGTTATCAGCCAGTTGACTGAAGATTGGGGGGAGACATTGTTTTCGGCATTGAGCAAAGCAGGTGGAAAAGGTTTCAGCAACATGGCTGTGGGTTACAACAA...

CDS

Download CDS FASTA

504 bp · TkA04G002550|TK1151|CDS

ATGGATCTTCTCAAAAATTCATTCGGCTCCACAGTGCTCGCTATCAAAAGAATCGAAGGTTACGAGTTGAAGTATGGAACCCTAATGATATGCACAGAGAAGAAAACGATATTGTCTGTTGAAGACATCATCGCTTTGATCGGAAACAGGTGCGATGGAGTTATCAGCCAGTTGACTGAAGATTGGGGGGAGACATTGTTTTCGGCATTGAGCAAAGCAGGTGGAAAAGGTTTCAGCAACATGGCTGTGGGTTACAACAA...

Protein

Download Protein FASTA

167 aa · TkA04G002550|TK1151|PROTEIN

MDLLKNSFGSTVLAIKRIEGYELKYGTLMICTEKKTILSVEDIIALIGNRCDGVISQLTEDWGETLFSALSKAGGKGFSNMAVGYNNVDVSAATKYGVAVGNTPGVLTETTAELAASLSLAASRRIVKADGLMRAGLYDGWLPHLFVGNLLKGQTVGVIGAGCIGSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G002550`
TK1151 ID	TkA04G002550
OH-1004 ID	LXL04_025313
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.700
Protein coverage (%)	TK1151 82.635 / OH-1004 29.114 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G002550

Location Chr04:658512-659504 (+)

Description Similar to HPR-A: Glycerate dehydrogenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68010`	Catalyzes the NADH-dependent reduction of hydroxypyruvate into glycerate in the photorespiratory core cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025313 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009853 photorespiration Biological Process

GO:0009854 oxidative photosynthetic carbon pathway Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0071482 cellular response to light stimulus Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0008266 poly(U) RNA binding Molecular Function

GO:0008465 hydroxypyruvate reductase (NADH) activity Molecular Function

KEGG gene cross-reference

ath:AT1G68010

csv:101209132

tlt:OCC_02245

ton:TON_0945

tpe:Tpen_0823

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.326

Rank 1 · TkA04G002550 · TK1151

Peroxisome0.189

Rank 2 · TkA04G002550 · TK1151

Extracellular0.171

Rank 3 · TkA04G002550 · TK1151

Nucleus0.108

Rank 4 · TkA04G002550 · TK1151

Plastid0.093

Rank 5 · TkA04G002550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29304ECU07_1090_N6-41 aa

PF003892-Hacid_dh38-126 aa

PF028262-Hacid_dh_C118-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G002550	`PF29304`	ECU07_1090_N	6	41	0.28	11.9
TkA04G002550	`PF00389`	2-Hacid_dh	38	126	1e-14	55.1
TkA04G002550	`PF02826`	2-Hacid_dh_C	118	167	9.2e-06	25.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9W5`	Arabidopsis thaliana	sp\|Q9C9W5\|HPR1_ARATH Glycerate dehydrogenase HPR, peroxisomal	87.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card