LXL04_025313 | RubberDandelionOmics

Gene overview

LXL04_025313

Reference: OH-1004 Chr: Chr05 Coordinates: 109703427-109705793 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1425 bp · LXL04_025313|LXL04_025313|OH1004|cDNA

ATGATCAAAATCAAAGGACTCCCTCCACTCAACAAGGTAGTCCTCCCACATCCAATCAACCCAATCAGCAAGTTCAAAAAGCTTCAGGGTGATGAAGCCCACACTCATTTCACCCGCTCAGCCACAGCCAATTCGTTCCCCAATTTCAAGTTTTCTGAAATGGCGAGACCAGTTTCCATTGAAGTATGGAACCCTAATGGTAAATACAGAGTTGTCAGCACAAAATCCATGCCCGGTACACGCTGGATTAATCTACTGGT...

CDS

Download CDS FASTA

1425 bp · LXL04_025313|LXL04_025313|OH1004|CDS

ATGATCAAAATCAAAGGACTCCCTCCACTCAACAAGGTAGTCCTCCCACATCCAATCAACCCAATCAGCAAGTTCAAAAAGCTTCAGGGTGATGAAGCCCACACTCATTTCACCCGCTCAGCCACAGCCAATTCGTTCCCCAATTTCAAGTTTTCTGAAATGGCGAGACCAGTTTCCATTGAAGTATGGAACCCTAATGGTAAATACAGAGTTGTCAGCACAAAATCCATGCCCGGTACACGCTGGATTAATCTACTGGT...

Protein

Download Protein FASTA

474 aa · LXL04_025313|LXL04_025313|OH1004|PROTEIN

MIKIKGLPPLNKVVLPHPINPISKFKKLQGDEAHTHFTRSATANSFPNFKFSEMARPVSIEVWNPNGKYRVVSTKSMPGTRWINLLVQQDCRVEICTEKKTILSVEDIIALIGNRCDGVIGQLTEDWGETLFSALSKAGGKAFSNMAVGYNNVDISAATKYGVAVGNTPGVLTETTAELAASLSLAASRRIVEADGFMRAGLYDGWLPHLFVGNLLKGQTVGVIGAGRIGSAYARMMVNSCTSGIYDYTFVTKLEKNCQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025313`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025313

Location Chr05:109703427-109705793 (-)

Description Similar to HPR-A: Glycerate dehydrogenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68010`	Catalyzes the NADH-dependent reduction of hydroxypyruvate into glycerate in the photorespiratory core cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025313 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009853 photorespiration Biological Process

GO:0009854 oxidative photosynthetic carbon pathway Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0071482 cellular response to light stimulus Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0008266 poly(U) RNA binding Molecular Function

GO:0008465 hydroxypyruvate reductase (NADH) activity Molecular Function

KEGG gene cross-reference

ath:AT1G68010

csv:101209132

tlt:OCC_02245

ton:TON_0945

tpe:Tpen_0823

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.429

Rank 1 · LXL04_025313 · OH-1004

Mitochondrion0.193

Rank 2 · LXL04_025313 · OH-1004

Cytoplasm0.190

Rank 3 · LXL04_025313 · OH-1004

Peroxisome0.138

Rank 4 · LXL04_025313 · OH-1004

Nucleus0.074

Rank 5 · LXL04_025313 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00389.372-Hacid_dh86-423 aa

PF02826.262-Hacid_dh_C183-238 aa

PF02826.262-Hacid_dh_C282-397 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025313	`PF00389.37`	2-Hacid_dh	86	423	3.1e-17	63.2
LXL04_025313	`PF02826.26`	2-Hacid_dh_C	183	238	1.6e-43	148.8
LXL04_025313	`PF02826.26`	2-Hacid_dh_C	282	397	1.6e-43	148.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9W5`	Arabidopsis thaliana	Glycerate dehydrogenase HPR, peroxisomal	82.836%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card