TkA04G001790 | RubberDandelionOmics

Gene overview

TkA04G001790

Reference: TK1151 Chr: Chr04 Coordinates: 448307-450979 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2216 bp · TkA04G001790|TK1151|cDNA

GTGGAGGCTTCGGTAATAAACGCACAATAGACCTTCTCTTCCTCTCCCCTATCCATCCAAAAATAAACCCTTCCCATGCTCATGGATGCTCTCTCCTTAAACGCCTTGATATTCGGGATCACCGCTCGCATTATTGAAACCCGTACAATCCCATCTCACGTTACCACCTTCCGCACCACCACAACTGCTATCTCCTCCGAGAAATCGATTTCTCCTCTACCACCTAAGACAGGGTCATGGAGTTTCTCTCTGAGATACCC...

CDS

Download CDS FASTA

1764 bp · TkA04G001790|TK1151|CDS

ATGCTCATGGATGCTCTCTCCTTAAACGCCTTGATATTCGGGATCACCGCTCGCATTATTGAAACCCGTACAATCCCATCTCACGTTACCACCTTCCGCACCACCACAACTGCTATCTCCTCCGAGAAATCGATTTCTCCTCTACCACCTAAGACAGGGTCATGGAGTTTCTCTCTGAGATACCCTCTTACATCTTTGCTTTCCGGCGACTGTAACCGGTGCTATGCGGTGACTGCGGAAGACGCCGTTTCGGAAGACGA...

Protein

Download Protein FASTA

587 aa · TkA04G001790|TK1151|PROTEIN

MLMDALSLNALIFGITARIIETRTIPSHVTTFRTTTTAISSEKSISPLPPKTGSWSFSLRYPLTSLLSGDCNRCYAVTAEDAVSEDEKEESERNENWLLRVLQVRSFWNTHGDEHVNNRAQNETDHDNEVSIDEECDACRVDDDGDDEDKLEFDRDSFSKLLSTVSLADARLYVQMAYLGSLSYTIPKIKLGNLLKRHRLRYVTSSLEKKAELAAKAKKEKASEEVGKGEFTNSETFVVKQSVEDDLNLLYSSPCEWFIC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G001790`
TK1151 ID	TkA04G001790
OH-1004 ID	LXL04_037115
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G001790

Location Chr04:448307-450979 (+)

Description Similar to PLIP3: Phospholipase A1 PLIP3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02660`	Sn-1-specific phospholipase A1 that catalyzes the initial step of oxylipins and jasmonate (JA) biosynthesis.	Two Abscisic Acid-Responsive Plastid Lipase Genes Involved in Jasmonic Acid Biosynthesis in <i>Arabidopsis thaliana</i>.2018 · DOI: 10.1105/tpc.18.00250
`At3g62590`	Sn-1-specific phospholipase A1 that catalyzes the initial step of oxylipins and jasmonate (JA) biosynthesis.	Two Abscisic Acid-Responsive Plastid Lipase Genes Involved in Jasmonic Acid Biosynthesis in <i>Arabidopsis thaliana</i>.2018 · DOI: 10.1105/tpc.18.00250
`At3g61680`	Sn-1-specific phospholipase A1 involved in seed oil biosynthesis.	A Plastid Phosphatidylglycerol Lipase Contributes to the Export of Acyl Groups from Plastids for Seed Oil Biosynthesis.2017 · DOI: 10.1105/tpc.17.00397

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037115 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0008970 glycerophospholipid phospholipase A1 activity Molecular Function

KEGG gene cross-reference

ath:AT1G02660

ath:AT3G61680

ath:AT3G62590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.822

Rank 1 · TkA04G001790 · TK1151

Cytoplasm0.105

Rank 2 · TkA04G001790 · TK1151

Nucleus0.085

Rank 3 · TkA04G001790 · TK1151

Cell membrane0.071

Rank 4 · TkA04G001790 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA04G001790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10380CRF133-144 aa

PF10380CRF1209-221 aa

PF01764Lipase_3271-408 aa

PF00756Esterase309-348 aa

PF26363Phospholipase-like319-344 aa

PF27153BrxC_ab501-523 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G001790	`PF10380`	CRF1	33	144	0.071	14.1
TkA04G001790	`PF10380`	CRF1	209	221	0.071	14.1
TkA04G001790	`PF01764`	Lipase_3	271	408	6.6e-25	88.4
TkA04G001790	`PF00756`	Esterase	309	348	0.019	15.4
TkA04G001790	`PF26363`	Phospholipase-like	319	344	0.26	11.2
TkA04G001790	`PF27153`	BrxC_ab	501	523	0.18	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HXL0`	Arabidopsis thaliana	sp\|F4HXL0\|PLIP2_ARATH Phospholipase A1 PLIP2, chloroplastic	46.200%	Swiss-Prot	Medium
`Q940L4`	Arabidopsis thaliana	sp\|Q940L4\|PLIP3_ARATH Phospholipase A1 PLIP3, chloroplastic	47.100%	Swiss-Prot	Medium
`Q7Y220`	Arabidopsis thaliana	sp\|Q7Y220\|PLIP1_ARATH Phospholipase A1 PLIP1, chloroplastic	41.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card