RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G608340
Reference: TK1151 Chr: Chr03 Coordinates: 154483049-154486018 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2165 bp · TkA03G608340|TK1151|cDNA

GATTAACCTAATCGGACCAGGTGAACGTGCCCGGCCAATAGGCACTTGGGTGGGCGATCTTAGTAGTGGAGCCGTGCCAGACACTTCTCTAATCAAACCTCAAAATCCGACTGCCAATCTAGTGATCTACACACGACGACGAGCGACACAAATAGGAGAGAAAGGGACAGGATTTGATTGTTTTATCGCCAAGAAAGGTGTTAGATTGGGGGAAAAGATAGGGAGATAGTGGATTCGTATTGTAATAATGGTGAATTTGA...

CDS

Download CDS FASTA

1296 bp · TkA03G608340|TK1151|CDS

ATGGATCCTTCCACATCTCGTCCTGCTGTAGTCATCGACAACGGCACCGGGTATACTAAAATGGGGTTTGCTGGTAACGTGGAGCCCTGTTTCATTTCTCCCACGGTAGTTGCAGTTAACGAATCCTTCATAACTCAGCCCAATCGTAGCTCTACTAAGGGAAGTAGCAGTTGGCTGACTCAGCACAGCGCTGGTGTAATGGCTGATCTGGATTTCTTTATTGGCGAAGAAGCCATATCCAAATCAAGAAGTAGCAGTAC...

Protein

Download Protein FASTA

431 aa · TkA03G608340|TK1151|PROTEIN

MDPSTSRPAVVIDNGTGYTKMGFAGNVEPCFISPTVVAVNESFITQPNRSSTKGSSSWLTQHSAGVMADLDFFIGEEAISKSRSSSTYSLTYPIKNGQVENWDAMERFWQQCIFNYLRCDPEDHYFLLTESPLTPPESREYTGEIMFETFNVPGLYIAVQPVLALAAGYTTHKCEMTGVVVDVGDGGTHVVPVAEGYVIGSSIKSIPISGKDVTLFVQQLMRERGEHVPPEDSLEVARKIKETYCYTCADIVKEYNKHDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G608340
TK1151 IDTkA03G608340
OH-1004 IDLXL04_011644
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G608340
LocationChr03:154483049-154486018 (+)
DescriptionSimilar to ARP3: Actin-related protein 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g13180 Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
Requirements for Arabidopsis ATARP2 and ATARP3 during epidermal development.2003 · DOI: 10.1016/s0960-9822(03)00493-7

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2X6S3 Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. No verified direct reference in this release
Os02g0596900 Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011644 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000902 cell morphogenesis Biological Process
GO:0006887 exocytosis Biological Process
GO:0006909 phagocytosis Biological Process
GO:0007015 actin filament organization Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009825 multidimensional cell growth Biological Process
GO:0010090 trichome morphogenesis Biological Process
GO:0030041 actin filament polymerization Biological Process
GO:0034314 Arp2/3 complex-mediated actin nucleation Biological Process
GO:0045010 actin nucleation Biological Process
GO:0046689 response to mercury ion Biological Process
GO:0001891 phagocytic cup Cellular Component
KEGG gene cross-reference
ath:AT1G13180
ddi:DDB_G0283755
dosa:Os02g0596900
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.619
Rank 1 · TkA03G608340 · TK1151
Nucleus0.477
Rank 2 · TkA03G608340 · TK1151
Cell membrane0.118
Rank 3 · TkA03G608340 · TK1151
Mitochondrion0.043
Rank 4 · TkA03G608340 · TK1151
Endoplasmic reticulum0.033
Rank 5 · TkA03G608340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00022Actin7-231 aa
PF14450FtsA10-31 aa
PF06723MreB_Mbl164-227 aa
PF14450FtsA179-260 aa
PF21522MreB-like_C180-267 aa
PF00022Actin234-422 aa
PF06723MreB_Mbl329-356 aa
PF21522MreB-like_C336-379 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G608340PF00022Actin72316.6e-82276.0
TkA03G608340PF14450FtsA10310.1613.1
TkA03G608340PF06723MreB_Mbl1642270.003716.9
TkA03G608340PF14450FtsA1792600.1613.1
TkA03G608340PF21522MreB-like_C1802670.2112.8
TkA03G608340PF00022Actin2344226.6e-82276.0
TkA03G608340PF06723MreB_Mbl3293560.003716.9
TkA03G608340PF21522MreB-like_C3363790.2112.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SAF1Arabidopsis thalianasp|Q9SAF1|ARP3_ARATH Actin-related protein 382.600%Swiss-ProtHigh
A2X6S3Oryza sativa subsp. indicasp|A2X6S3|ARP3_ORYSI Actin-related protein 382.900%Swiss-ProtHigh
Q6K908Oryza sativa subsp. japonicasp|Q6K908|ARP3_ORYSJ Actin-related protein 382.900%Swiss-ProtHigh

JBrowse

View in Genome Browser