LXL04_011644 | RubberDandelionOmics

Gene overview

LXL04_011644

Reference: OH-1004 Chr: Chr02 Coordinates: 168757903-168759999 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1296 bp · LXL04_011644|LXL04_011644|OH1004|cDNA

ATGGATCCTTCCACATCTCGTCCTGCTGTAGTCATCGACAACGGCACCGGGTATACTAAAATGGGGTTTGCTGGTAACGTGGAGCCCTGTTTCATTTCTCCCACGGTAGTTGCAGTTAACGAATCCTTCATAACTCAGCCCAATCGTAGCTCTACTAAGGGAAGTAGCAGTTGGCTGACTCAGCACAGCGCTGGTGTAATGGCTGATCTGGATTTCTTTATTGGCGAAGAAGCCATATCCAAATCAAGAAGTAGCAGTAC...

CDS

Download CDS FASTA

1296 bp · LXL04_011644|LXL04_011644|OH1004|CDS

ATGGATCCTTCCACATCTCGTCCTGCTGTAGTCATCGACAACGGCACCGGGTATACTAAAATGGGGTTTGCTGGTAACGTGGAGCCCTGTTTCATTTCTCCCACGGTAGTTGCAGTTAACGAATCCTTCATAACTCAGCCCAATCGTAGCTCTACTAAGGGAAGTAGCAGTTGGCTGACTCAGCACAGCGCTGGTGTAATGGCTGATCTGGATTTCTTTATTGGCGAAGAAGCCATATCCAAATCAAGAAGTAGCAGTAC...

Protein

Download Protein FASTA

431 aa · LXL04_011644|LXL04_011644|OH1004|PROTEIN

MDPSTSRPAVVIDNGTGYTKMGFAGNVEPCFISPTVVAVNESFITQPNRSSTKGSSSWLTQHSAGVMADLDFFIGEEAISKSRSSSTYSLTYPIKNGQVENWDAMERFWQQCIFNYLRCDPEDHYFLLTESPLTPPESREYTGEIMFETFNVPGLYIAVQPVLALAAGYTTHKCEMTGVVVDVGDGGTHVVPVAEGYVIGSSIKSIPISGKDVTLFVQQLMRERGEHVPPEDSLEVARKIKETYCYTCADIVKEYNKHDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011644`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011644

Location Chr02:168757903-168759999 (+)

Description Similar to ARP3: Actin-related protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13180`	Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.	Requirements for Arabidopsis ATARP2 and ATARP3 during epidermal development.2003 · DOI: 10.1016/s0960-9822(03)00493-7

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0596900`	Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.	No verified direct reference in this release
`UniProt: A2X6S3`	Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011644 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0006887 exocytosis Biological Process

GO:0006909 phagocytosis Biological Process

GO:0007015 actin filament organization Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0030041 actin filament polymerization Biological Process

GO:0034314 Arp2/3 complex-mediated actin nucleation Biological Process

GO:0045010 actin nucleation Biological Process

GO:0046689 response to mercury ion Biological Process

GO:0001891 phagocytic cup Cellular Component

KEGG gene cross-reference

ath:AT1G13180

ddi:DDB_G0283755

dosa:Os02g0596900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.619

Rank 1 · LXL04_011644 · OH-1004

Nucleus0.477

Rank 2 · LXL04_011644 · OH-1004

Cell membrane0.118

Rank 3 · LXL04_011644 · OH-1004

Mitochondrion0.043

Rank 4 · LXL04_011644 · OH-1004

Endoplasmic reticulum0.033

Rank 5 · LXL04_011644 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00022.27Actin7-231 aa

PF00022.27Actin234-422 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011644	`PF00022.27`	Actin	7	231	6.6e-82	276.0
LXL04_011644	`PF00022.27`	Actin	234	422	6.6e-82	276.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAF1`	Arabidopsis thaliana	Actin-related protein 3	83.991%	Swiss-Prot	strong database homology
`Q6K908`	Oryza sativa subsp. japonica	Actin-related protein 3	82.831%	Swiss-Prot	strong database homology
`A2X6S3`	Oryza sativa subsp. indica	Actin-related protein 3	82.831%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card