TkA03G570690 | RubberDandelionOmics

Gene overview

TkA03G570690

Reference: TK1151 Chr: Chr03 Coordinates: 144771263-144776455 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3471 bp · TkA03G570690|TK1151|cDNA

ATGCTTTCAATGTTCTTCTTCAAATTCAAATGCACTTATATAGCTGACAATAATATTCGAACACCAGTTTCGAATGACAAATCTAACTCATCTTTTTCAAGTGCTATGACATCAACAAGGTCATATGCAAATATCCAAACTTCTTCATCCATCAAATTAGGTTTTGGAACTCATAAACTAAAAAGAAAGGCTGTTAGTTTACCCTCTATTCCTATGATTGACCTCACATCGGATGAAGATATTAATGATGAAGTTCCAGC...

CDS

Download CDS FASTA

3471 bp · TkA03G570690|TK1151|CDS

ATGCTTTCAATGTTCTTCTTCAAATTCAAATGCACTTATATAGCTGACAATAATATTCGAACACCAGTTTCGAATGACAAATCTAACTCATCTTTTTCAAGTGCTATGACATCAACAAGGTCATATGCAAATATCCAAACTTCTTCATCCATCAAATTAGGTTTTGGAACTCATAAACTAAAAAGAAAGGCTGTTAGTTTACCCTCTATTCCTATGATTGACCTCACATCGGATGAAGATATTAATGATGAAGTTCCAGC...

Protein

Download Protein FASTA

1156 aa · TkA03G570690|TK1151|PROTEIN

MLSMFFFKFKCTYIADNNIRTPVSNDKSNSSFSSAMTSTRSYANIQTSSSIKLGFGTHKLKRKAVSLPSIPMIDLTSDEDINDEVPAEAHIGGISKDYIDHGDQTVECPVCHAMLWAAESARSQKKPDGSFSLFYLKAKYFINNIRRYNSMFSFTSMGGRVDKEINKSRGPYVYRISGENYHRLRSLLPPDESQPKFSQLYIYDTDNEISNRQQIFSRPQDTSTSRSPSEDLDVIKFLKEMLDANNELVKSYRMVHDCFH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G570690`
TK1151 ID	TkA03G570690
OH-1004 ID	LXL04_033271
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.900
Protein coverage (%)	TK1151 96.107 / OH-1004 65.752 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G570690`
Location	Chr03:144771263-144776455 (-)
Description	Similar to Pif1: ATP-dependent DNA helicase PIF1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033271` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000722 telomere maintenance via recombination Biological Process GO:0000723 telomere maintenance Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0000727 double-strand break repair via break-induced replication Biological Process GO:0001117 protein-DNA-RNA complex disassembly Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0006310 DNA recombination Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0007140 male meiotic nuclear division Biological Process GO:0009555 pollen development Biological Process
KEGG gene cross-reference	cal:CAALFM_CR07360WA dosa:Os02g0776800 hsa:80119 mmu:208084 rno:367645 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.906

Rank 1 · TkA03G570690 · TK1151

Cytoplasm0.163

Rank 2 · TkA03G570690 · TK1151

Mitochondrion0.040

Rank 3 · TkA03G570690 · TK1151

Cell membrane0.014

Rank 4 · TkA03G570690 · TK1151

Extracellular0.008

Rank 5 · TkA03G570690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00225Kinesin753-805 aa

PF05970PIF1770-865 aa

PF10923BrxC_BrxD778-827 aa

PF13191AAA_16780-819 aa

PF13604AAA_30781-832 aa

PF13481AAA_25789-835 aa

PF05970PIF1864-925 aa

PF21530Pif1_2B_dom1024-1067 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G570690	`PF00225`	Kinesin	753	805	0.13	12.0
TkA03G570690	`PF05970`	PIF1	770	865	8.4e-56	189.8
TkA03G570690	`PF10923`	BrxC_BrxD	778	827	0.026	14.2
TkA03G570690	`PF13191`	AAA_16	780	819	0.049	14.9
TkA03G570690	`PF13604`	AAA_30	781	832	0.0042	17.6
TkA03G570690	`PF13481`	AAA_25	789	835	0.091	13.1
TkA03G570690	`PF05970`	PIF1	864	925	8.4e-56	189.8
TkA03G570690	`PF21530`	Pif1_2B_dom	1024	1067	1.5e-13	51.0
TkA03G570690	`PF02689`	Herpes_Helicase	1110	1154	0.01	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card