TkA03G561820 | RubberDandelionOmics

Gene overview

TkA03G561820

Reference: TK1151 Chr: Chr03 Coordinates: 142596869-142599003 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1603 bp · TkA03G561820|TK1151|cDNA

CGAATTTGAAGAGAAGAAGTTGAGAATATGCAAAATTTGAGATAAAAGTATCTGACATCATATCAACTTAAGTTCTCGCGGGGTCAATCTGTCGGCATTAGTCTTCCTTTTTACTGCAATCAATTTATACACCAAACCGATCCACCGCCTCGCCTCACTTCTCCTAACTTGGCCACCCAGATTTCAATCAGTTCTAGGGTTTAATCAAACCAAACAAAAGGGTCTGCGGTTCCGTCGAGCTTTCTGCTGATGCCGATCAT...

CDS

Download CDS FASTA

768 bp · TkA03G561820|TK1151|CDS

ATGGCTGATGAAGATATGAAAGATTCCAATTCCATATGGACCAGAGACCAAGACAAGGCTTTTGAAAACGCATTGGTAACTTATCCCGATGAAGACACCGAGGATCGATGGGAAAAAATTGCTGCTGATGTTCCTGGAAAATCAGTCGAAGAAATTAAACATCATTACGAGTTATTAATTGAAGATTTAGAAAGAATCGAGTCTGGTCTTGTTCCTTTACCTTGTTATAGCTCCTCATTGGATGACTCAGAAAGCCACGC...

Protein

Download Protein FASTA

255 aa · TkA03G561820|TK1151|PROTEIN

MADEDMKDSNSIWTRDQDKAFENALVTYPDEDTEDRWEKIAADVPGKSVEEIKHHYELLIEDLERIESGLVPLPCYSSSLDDSESHAGDGGPTKKSGNTTESNHGGKVSKSDQERRKGIAWTEDEHRLFLLGLEKYGKGDWRSISRNYVVTRTPTQVASHAQKYFIRLNSMNKDRRRSSIHDITSVNNGDVAVPQPPTNGSPVAKQPPGGGMYGGTTIGQPVGPAVGTPVSLAPPPPHMAYGAPANMDPRGSRHR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G561820`
TK1151 ID	TkA03G561820
OH-1004 ID	LXL04_008789
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.700
Protein coverage (%)	TK1151 92.549 / OH-1004 83.673 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G561820

Location Chr03:142596869-142599003 (+)

Description Similar to MYBS1: Transcription factor MYBS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08520`	Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'.	Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.2015 · DOI: 10.1104/pp.15.00962

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8A9B2`	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters.	No verified direct reference in this release
`Os01g0524500`	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters.	Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of alpha-amylase gene expression.2002 · DOI: 10.1105/tpc.001735 Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals.2012 · DOI: 10.1105/tpc.112.097741

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008789 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT5G08520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.941

Rank 1 · TkA03G561820 · TK1151

Cytoplasm0.186

Rank 2 · TkA03G561820 · TK1151

Cell membrane0.020

Rank 3 · TkA03G561820 · TK1151

Mitochondrion0.014

Rank 4 · TkA03G561820 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA03G561820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01285TEA10-34 aa

PF00249Myb_DNA-binding13-56 aa

PF23082Myb_DNA-binding_213-57 aa

PF21227Myb_DNA-binding_713-60 aa

PF13921Myb_DNA-bind_633-65 aa

PF00249Myb_DNA-binding120-165 aa

PF23082Myb_DNA-binding_2121-161 aa

PF13921Myb_DNA-bind_6121-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G561820	`PF01285`	TEA	10	34	0.00023	22.1
TkA03G561820	`PF00249`	Myb_DNA-binding	13	56	9.4e-22	77.6
TkA03G561820	`PF23082`	Myb_DNA-binding_2	13	57	1.7e-05	25.6
TkA03G561820	`PF21227`	Myb_DNA-binding_7	13	60	0.11	13.1
TkA03G561820	`PF13921`	Myb_DNA-bind_6	33	65	0.00015	22.5
TkA03G561820	`PF00249`	Myb_DNA-binding	120	165	9.4e-22	77.6
TkA03G561820	`PF23082`	Myb_DNA-binding_2	121	161	1.7e-05	25.6
TkA03G561820	`PF13921`	Myb_DNA-bind_6	121	158	0.00015	22.5
TkA03G561820	`PF01285`	TEA	121	138	0.00023	22.1
TkA03G561820	`PF21227`	Myb_DNA-binding_7	121	158	0.11	13.1
TkA03G561820	`PF01285`	TEA	146	162	0.00023	22.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNN6`	Arabidopsis thaliana	sp\|Q9FNN6\|SRM1_ARATH Transcription factor SRM1	59.700%	Swiss-Prot	High
`B8A9B2`	Oryza sativa subsp. indica	sp\|B8A9B2\|MYBS1_ORYSI Transcription factor MYBS1	48.600%	Swiss-Prot	Medium
`Q8LH59`	Oryza sativa subsp. japonica	sp\|Q8LH59\|MYBS1_ORYSJ Transcription factor MYBS1	48.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card