LXL04_008789 | RubberDandelionOmics

Gene overview

LXL04_008789

Reference: OH-1004 Chr: Chr02 Coordinates: 108880457-108881863 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

885 bp · LXL04_008789|LXL04_008789|OH1004|cDNA

ATGTCATCATCTAAAGTCTGGACCAAAGAAGAAGATAAGGCATTCGAGAATGCCATTGCCAACCACTGGACTCACGATTCCAAGGAACAATGGGATACAATTGCTTCCCTCATCCCCACCAAAACCATTCCGGAGTTGAAACAACACTATCGGTTACTCACAGAAGATGTTGACGACATTGAAGCCGGACTGATTCCGGTTCCCAAGTATCTCGGAGAGGAATCCTCCTCCTCTTCCACCAAAGAAACCAACAACCACCA...

CDS

Download CDS FASTA

885 bp · LXL04_008789|LXL04_008789|OH1004|CDS

ATGTCATCATCTAAAGTCTGGACCAAAGAAGAAGATAAGGCATTCGAGAATGCCATTGCCAACCACTGGACTCACGATTCCAAGGAACAATGGGATACAATTGCTTCCCTCATCCCCACCAAAACCATTCCGGAGTTGAAACAACACTATCGGTTACTCACAGAAGATGTTGACGACATTGAAGCCGGACTGATTCCGGTTCCCAAGTATCTCGGAGAGGAATCCTCCTCCTCTTCCACCAAAGAAACCAACAACCACCA...

Protein

Download Protein FASTA

294 aa · LXL04_008789|LXL04_008789|OH1004|PROTEIN

MSSSKVWTKEEDKAFENAIANHWTHDSKEQWDTIASLIPTKTIPELKQHYRLLTEDVDDIEAGLIPVPKYLGEESSSSSTKETNNHHGSNSSRRSSCNYTNGFSGFGHDSNSAGQSSGKANSRAEQERRKGIPWTEEEHRLFLLGLDKFGKGDWRSISRNYVISRTPTQVASHAQKYFIRLHSMNRDRRRTSIHDITSVNNGDVASHQIPITGQPGSTNPGSGPTVGAPMKHRPHHPVPPGMGMYGAPMGHPVAAAPGHM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008789`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008789

Location Chr02:108880457-108881863 (+)

Description Similar to MYBS1: Transcription factor MYBS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08520`	Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'.	Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.2015 · DOI: 10.1104/pp.15.00962

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0524500`	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters.	Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of alpha-amylase gene expression.2002 · DOI: 10.1105/tpc.001735 Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals.2012 · DOI: 10.1105/tpc.112.097741
`UniProt: B8A9B2`	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters.	No verified direct reference in this release
`Os10g0561400`	Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters.	Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of alpha-amylase gene expression.2002 · DOI: 10.1105/tpc.001735 A novel MYBS3-dependent pathway confers cold tolerance in rice.2010 · DOI: 10.1104/pp.110.153015

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008789 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT5G08520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.886

Rank 1 · LXL04_008789 · OH-1004

Cytoplasm0.269

Rank 2 · LXL04_008789 · OH-1004

Cell membrane0.019

Rank 3 · LXL04_008789 · OH-1004

Mitochondrion0.017

Rank 4 · LXL04_008789 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_008789 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding6-51 aa

PF00249.38Myb_DNA-binding133-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008789	`PF00249.38`	Myb_DNA-binding	6	51	6.6e-22	78.1
LXL04_008789	`PF00249.38`	Myb_DNA-binding	133	178	6.6e-22	78.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNN6`	Arabidopsis thaliana	Transcription factor SRM1	48.693%	Swiss-Prot	moderate database homology
`Q8LH59`	Oryza sativa subsp. japonica	Transcription factor MYBS1	53.443%	Swiss-Prot	strong database homology
`B8A9B2`	Oryza sativa subsp. indica	Transcription factor MYBS1	53.443%	Swiss-Prot	strong database homology
`Q7XC57`	Oryza sativa subsp. japonica	Transcription factor MYBS3	61.290%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card