TkA03G557280 | RubberDandelionOmics

Gene overview

TkA03G557280

Reference: TK1151 Chr: Chr03 Coordinates: 141048808-141051612 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

939 bp · TkA03G557280|TK1151|cDNA

ATGAACAGCAACGGTGTTTTGAACAAATCTCAAGAACAACAACTATCAGTACGACCTCACACGAACATCATCAGGTTGCGAGATCTGATGAGTTCTAAAGAAAAGAACGAAAAACTTTATATAGATCTAGATTCAGAACAGCAAACCGAAGCAGATCTACCTCACGAAAAAAATCCGCTCTTCAAAGGATCCACTATGACCTCTCGCGGTGCTTATGCTGCCGTCTCTTACATGTCTTGCGCTGTAACTTGCTTTACTAT...

CDS

Download CDS FASTA

939 bp · TkA03G557280|TK1151|CDS

ATGAACAGCAACGGTGTTTTGAACAAATCTCAAGAACAACAACTATCAGTACGACCTCACACGAACATCATCAGGTTGCGAGATCTGATGAGTTCTAAAGAAAAGAACGAAAAACTTTATATAGATCTAGATTCAGAACAGCAAACCGAAGCAGATCTACCTCACGAAAAAAATCCGCTCTTCAAAGGATCCACTATGACCTCTCGCGGTGCTTATGCTGCCGTCTCTTACATGTCTTGCGCTGTAACTTGCTTTACTAT...

Protein

Download Protein FASTA

312 aa · TkA03G557280|TK1151|PROTEIN

MNSNGVLNKSQEQQLSVRPHTNIIRLRDLMSSKEKNEKLYIDLDSEQQTEADLPHEKNPLFKGSTMTSRGAYAAVSYMSCAVTCFTMENMRRRNIAKADRSKLISEALRKMKGKLSEIAGSHVSCRVLQVIIKTYAIHLITKMLDNASKEQLAEFISSLHGHVASLLRHMVGSVVDHYILYKALVEYFTIADKTSADVIQHLSSALLERKKITKGMKGHVSKIAQDRYGSMVLTCILFVVDDTQLVKKIIIRELQGVLKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G557280`
TK1151 ID	TkA03G557280
OH-1004 ID	LXL04_017384
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.700
Protein coverage (%)	TK1151 77.564 / OH-1004 67.866 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G557280

Location Chr03:141048808-141051612 (-)

Description Similar to APUM24: Pumilio homolog 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16810`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017384 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006417 regulation of translation Biological Process

GO:0006465 signal peptide processing Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0010835 regulation of protein ADP-ribosylation Biological Process

GO:0051604 protein maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G06870

ath:AT2G30440

ath:AT3G16810

ath:AT3G24590

rno:499339

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.641

Rank 1 · TkA03G557280 · TK1151

Cytoplasm0.288

Rank 2 · TkA03G557280 · TK1151

Endoplasmic reticulum0.055

Rank 3 · TkA03G557280 · TK1151

Mitochondrion0.045

Rank 4 · TkA03G557280 · TK1151

Cell membrane0.043

Rank 5 · TkA03G557280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12631MnmE_helical92-132 aa

PF22493PUF_NOP9101-133 aa

PF22493PUF_NOP9140-175 aa

PF12631MnmE_helical142-213 aa

PF08144CPL154-172 aa

PF22493PUF_NOP9198-268 aa

PF08144CPL213-241 aa

PF12631MnmE_helical246-262 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G557280	`PF12631`	MnmE_helical	92	132	0.066	14.0
TkA03G557280	`PF22493`	PUF_NOP9	101	133	3.3e-07	30.3
TkA03G557280	`PF22493`	PUF_NOP9	140	175	3.3e-07	30.3
TkA03G557280	`PF12631`	MnmE_helical	142	213	0.066	14.0
TkA03G557280	`PF08144`	CPL	154	172	0.0017	19.4
TkA03G557280	`PF22493`	PUF_NOP9	198	268	3.3e-07	30.3
TkA03G557280	`PF08144`	CPL	213	241	0.0017	19.4
TkA03G557280	`PF12631`	MnmE_helical	246	262	0.066	14.0
TkA03G557280	`PF08144`	CPL	264	292	0.0017	19.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRZ3`	Arabidopsis thaliana	sp\|Q9LRZ3\|PUM24_ARATH Pumilio homolog 24	44.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card