LXL04_017384 | RubberDandelionOmics

Gene overview

LXL04_017384

Reference: OH-1004 Chr: Chr03 Coordinates: 147989660-147992943 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1170 bp · LXL04_017384|LXL04_017384|OH1004|cDNA

ATGATGCCATCAAGCGACCGTATGAGCTTAACGGTGTCGGATCCTCCTCCTCAGCAAAAAGGCAGCGCCGGCGAACAGAGGCTCTTCAAAGGATCCACTATGACCTCTCGCGGTGCTTATGCTGCCGTCTCTTACATGTCTTGCGCTGTAGCTTGCTTTACTATGGGAAAAGATGAGACGTTGATTAGTGAGGCATTAAGGAAGATGAAGGGCAAACTTTCTGAAATTGCAGGCTCCCATGTTTCTTGCCGTGTACTTCA...

CDS

Download CDS FASTA

1170 bp · LXL04_017384|LXL04_017384|OH1004|CDS

ATGATGCCATCAAGCGACCGTATGAGCTTAACGGTGTCGGATCCTCCTCCTCAGCAAAAAGGCAGCGCCGGCGAACAGAGGCTCTTCAAAGGATCCACTATGACCTCTCGCGGTGCTTATGCTGCCGTCTCTTACATGTCTTGCGCTGTAGCTTGCTTTACTATGGGAAAAGATGAGACGTTGATTAGTGAGGCATTAAGGAAGATGAAGGGCAAACTTTCTGAAATTGCAGGCTCCCATGTTTCTTGCCGTGTACTTCA...

Protein

Download Protein FASTA

389 aa · LXL04_017384|LXL04_017384|OH1004|PROTEIN

MMPSSDRMSLTVSDPPPQQKGSAGEQRLFKGSTMTSRGAYAAVSYMSCAVACFTMGKDETLISEALRKMKGKLSEIAGSHVSCRVLQVIIKTYAIHLITKMLDNASKEQLAEFISSLHGHVASLLRHMVGSVVVEHVYQLGNATQKQSLLMKNVDIITKLNLQKSYLLLIRHVWIQTCAADVIQHLSSALLVRMIHTKDRANIGIQCIKHGSAQERKKITKGMKGHVSKIAQDRYGSMMIIRELQGVLTELILDKNGRRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017384`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017384

Location Chr03:147989660-147992943 (-)

Description Similar to APUM24: Pumilio homolog 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16810`	Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs.	No verified direct reference in this release
`At1g06870`	Cleaves the thylakoid-transfer domain from a chloroplast protein.	No verified direct reference in this release
`At2g30440`	Cleaves the thylakoid-transfer domain from a chloroplast protein.	No verified direct reference in this release
`At3g24590`	Involved in the maturation of the plastid protein translocation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017384 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006417 regulation of translation Biological Process

GO:0006465 signal peptide processing Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0010835 regulation of protein ADP-ribosylation Biological Process

GO:0051604 protein maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G06870

ath:AT2G30440

ath:AT3G16810

ath:AT3G24590

rno:499339

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.358

Rank 1 · LXL04_017384 · OH-1004

Cytoplasm0.343

Rank 2 · LXL04_017384 · OH-1004

Endoplasmic reticulum0.133

Rank 3 · LXL04_017384 · OH-1004

Mitochondrion0.116

Rank 4 · LXL04_017384 · OH-1004

Cell membrane0.082

Rank 5 · LXL04_017384 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10502.15Peptidase_S26312-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017384	`PF10502.15`	Peptidase_S26	312	363	1.7e-10	41.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRZ3`	Arabidopsis thaliana	Pumilio homolog 24	46.273%	Swiss-Prot	moderate database homology
`Q9M9Z2`	Arabidopsis thaliana	Probable thylakoidal processing peptidase 2, chloroplastic	51.220%	Swiss-Prot	weak database homology
`O04348`	Arabidopsis thaliana	Thylakoidal processing peptidase 1, chloroplastic	50.000%	Swiss-Prot	weak database homology
`Q8H0W1`	Arabidopsis thaliana	Chloroplast processing peptidase	45.614%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card