Gene Card
Gene overview
cDNA / CDS / Protein Sequences
5052 bp · TkA03G555810|TK1151|cDNA
AAATGTTAACCCAAATCTAAACACGCTAGGATTCGAGCCTCACCACCGCCTTCTCAACGCCCCACTGCACTACTACTATCAGGGGTTGAGTAGGGTTTCACATTTGTATTTCAGAAATTCTTTCCGAAAGAACTCCATTCAAACCCTCCTTCAAAATCATCCAATTTGAAGTTCATGCCCTAATAGGAATTCTTGCACATTTTGTAGGCAGAATTAGCAGCAATATCTCAAATTGTCGATCCAGTAAAGCCGACCAATGA...
4551 bp · TkA03G555810|TK1151|CDS
ATGACGAAAGTATACGGAACTGGAGTGTTCGACTTCAGGCGCCACCGTGTTGCGGAGTATCCCGTTACCGACGGTGGTCCCGACCAACCTGTTCCAGAAAGGCCGCCGGAATCAAAACCAGGTACCAATCTGCCAAGCTCGATGACCCTTGTTGAAATACAGCGGGACCGGCTCACTAAGATTGCGGATGCGAACTGGTCAAAAGCGGCATCAGACAACGAGAAACCTCCGTTTAGTGCGGAGCTGGTAAAGGAGATTTA...
Protein
Download Protein FASTA1516 aa · TkA03G555810|TK1151|PROTEIN
MTKVYGTGVFDFRRHRVAEYPVTDGGPDQPVPERPPESKPGTNLPSSMTLVEIQRDRLTKIADANWSKAASDNEKPPFSAELVKEIYETELLVKEDKTGRMRRTVPLQRVMILEVSQYLENYLWPNFDPEKSSFEHVMSMILMINEKFRENVAAWICFYDRKDTFKAFLERVLCLKEGRTLSIAEKTNYLLFMINAFQSLEDDIVSKKVMRLASLHCWHSLSFGRFQMELCLNPDLIKKWKRIAKKAKEAKKRGESFDMS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G555810 |
|---|---|
| TK1151 ID | TkA03G555810 |
| OH-1004 ID | LXL04_010929 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G555810 |
|---|---|
| Location | Chr03:140709001-140715291 (-) |
| Description | Similar to AQR: RNA helicase aquarius |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0002218 activation of innate immune response Biological Process GO:0031048 regulatory ncRNA-mediated heterochromatin formation Biological Process GO:0042742 defense response to bacterium Biological Process GO:0045071 negative regulation of viral genome replication Biological Process GO:0045087 innate immune response Biological Process GO:0045292 mRNA cis splicing, via spliceosome Biological Process GO:0051607 defense response to virus Biological Process GO:0000974 Prp19 complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component |
| KEGG gene cross-reference | hsa:57169 hsa:9716 mmu:11834 mmu:98999 spo:2541124 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16399Aquarius_N_1st58-473 aaPF21144Aquarius_N_3rd66-103 aaPF21143Aquarius_N_2nd278-295 aaPF00580UvrD-helicase423-455 aaPF21143Aquarius_N_2nd556-724 aaPF13087AAA_12599-610 aaPF21144Aquarius_N_3rd774-870 aaPF13245AAA_19884-945 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G555810 | PF16399 | Aquarius_N_1st | 58 | 473 | 3.9e-133 | 445.0 |
| TkA03G555810 | PF21144 | Aquarius_N_3rd | 66 | 103 | 6.9e-21 | 75.5 |
| TkA03G555810 | PF21143 | Aquarius_N_2nd | 278 | 295 | 3.1e-54 | 183.9 |
| TkA03G555810 | PF00580 | UvrD-helicase | 423 | 455 | 0.0064 | 16.9 |
| TkA03G555810 | PF21143 | Aquarius_N_2nd | 556 | 724 | 3.1e-54 | 183.9 |
| TkA03G555810 | PF13087 | AAA_12 | 599 | 610 | 6.2e-25 | 88.6 |
| TkA03G555810 | PF21144 | Aquarius_N_3rd | 774 | 870 | 6.9e-21 | 75.5 |
| TkA03G555810 | PF13245 | AAA_19 | 884 | 945 | 5.3e-08 | 33.8 |
| TkA03G555810 | PF13086 | AAA_11 | 891 | 1182 | 3.7e-28 | 99.7 |
| TkA03G555810 | PF13191 | AAA_16 | 891 | 949 | 0.068 | 14.4 |
| TkA03G555810 | PF13401 | AAA_22 | 892 | 943 | 0.015 | 16.3 |
| TkA03G555810 | PF13604 | AAA_30 | 893 | 941 | 0.00033 | 21.2 |
| TkA03G555810 | PF00580 | UvrD-helicase | 893 | 944 | 0.0064 | 16.9 |
| TkA03G555810 | PF04851 | ResIII | 895 | 942 | 0.0079 | 16.8 |
| TkA03G555810 | PF09848 | SLFN-g3_helicase | 895 | 947 | 0.018 | 15.1 |
| TkA03G555810 | PF00004 | AAA | 896 | 943 | 0.048 | 14.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.