Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2400 bp · TkA03G549230|TK1151|cDNA
AAGGGCCCAATGATATTATAACCTAACTATGGTTAACTTGTTCAACCCCTTTTGAACGACGTGCCACGGTTTAGATTAAGGAGCAGCACAAACACAAACACAAACCAGTAGCCAAAGCCTTTACCTCCATCATCTTTCTCTCTCTCAAAACAAAAACTTGTCTCCTTCTCTGAAATATCCACAGCTTTGCTACCATTAGAGGAAGAATTTTCCGCTTTTCTTATTGGGCCAACGGTGTGTCTATCAATTGCTTTGTTTCT...
483 bp · TkA03G549230|TK1151|CDS
ATGAAAACGGAGGTGAATATGGGAGGTGAGAGTTGGGACGATGAAGATAAAGCCATTGTTGCTGCGGTGCTAGGGTCTAGAGCGTTTGACTACTTGATTTCAAGCTCTGTTTCTAATGAATGCTCATCAACTTCGTTAGGAAATGACGAGAATCTGCAACACAAGCTCTCAGATCTTGTAGACCACCCAAATTCGTCGAATTTCAGTTGGAATTACGCAATATTTTGGCAAATCTCGAGGTCGAAAACAGGGGATTTGGT...
Protein
Download Protein FASTA160 aa · TkA03G549230|TK1151|PROTEIN
MKTEVNMGGESWDDEDKAIVAAVLGSRAFDYLISSSVSNECSSTSLGNDENLQHKLSDLVDHPNSSNFSWNYAIFWQISRSKTGDLVLGWGDGSCREPKEGEEFEIARILSFRMEDENQQRIRKKKRRRRPRQMFLLRPPRLDLRCIKFNFRLLLSISSS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G549230 |
|---|---|
| TK1151 ID | TkA03G549230 |
| OH-1004 ID | LXL04_022563 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 77.400 |
| Protein coverage (%) | TK1151 76.875 / OH-1004 22.878Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G549230 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:138936009-138938527 (-) | |||||||||
| Description | Similar to MTB1: Transcription factor MTB1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006952 defense response Biological Process GO:0009611 response to wounding Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0010629 negative regulation of gene expression Biological Process GO:0031347 regulation of defense response Biological Process GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G01260 ath:AT2G46510 ath:AT4G16430 sly:101247327 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14215bHLH-MYC_N52-108 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G549230 | PF14215 | bHLH-MYC_N | 52 | 108 | 1.3e-14 | 55.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.