LXL04_022563 | RubberDandelionOmics

Gene overview

LXL04_022563

Reference: OH-1004 Chr: Chr05 Coordinates: 1618656-1620284 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1629 bp · LXL04_022563|LXL04_022563|OH1004|cDNA

ATGAAACTAGAGGCGGCGAATATGGGCGGTGACAATTTTAATGATGAAGAGAAAGCGATTGTTGCGGCTGTTTTAGGAACTAGAGCATTCGATTACCTGATTTCCAGTTCCGCTGGTAATGAATGCTCATTAACTGCATTAGCGACCGATGATAGTTTACAAAACAAGCTCTCAGATCTCGTAGATAACCCTAATTCGGCTAATTTTAGTTGGAATTACGCTATTTTTTGGCAAATATCCCGCTCAAAGTCGGGAGATTT...

CDS

Download CDS FASTA

1629 bp · LXL04_022563|LXL04_022563|OH1004|CDS

ATGAAACTAGAGGCGGCGAATATGGGCGGTGACAATTTTAATGATGAAGAGAAAGCGATTGTTGCGGCTGTTTTAGGAACTAGAGCATTCGATTACCTGATTTCCAGTTCCGCTGGTAATGAATGCTCATTAACTGCATTAGCGACCGATGATAGTTTACAAAACAAGCTCTCAGATCTCGTAGATAACCCTAATTCGGCTAATTTTAGTTGGAATTACGCTATTTTTTGGCAAATATCCCGCTCAAAGTCGGGAGATTT...

Protein

Download Protein FASTA

542 aa · LXL04_022563|LXL04_022563|OH1004|PROTEIN

MKLEAANMGGDNFNDEEKAIVAAVLGTRAFDYLISSSAGNECSLTALATDDSLQNKLSDLVDNPNSANFSWNYAIFWQISRSKSGDLVLVWADGSCREPREGEEFEIARILSIRLEDENQQRMKKRVLQNLHVLFGGLDEDNYAFGLDRVTDTEMFFLISMYFSFPQGQGGPGKCFSSGYHLWYSDALRSTSDYCFRSNLSKSAGIQTVVLLPTDAGVLEVGSIRSIPENMDLLHSIRSSFPSTPNNSLVSPILSKILNH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022563`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022563

Location Chr05:1618656-1620284 (+)

Description Similar to MTB1: Transcription factor MTB1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01260`	Transcription factor bHLH13.	No verified direct reference in this release
`At2g46510`	Transcription activator.	No verified direct reference in this release
`At4g16430`	Transcription factor bHLH3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022563 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0031347 regulation of defense response Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G01260

ath:AT2G46510

ath:AT4G16430

sly:101247327

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.862

Rank 1 · LXL04_022563 · OH-1004

Cytoplasm0.187

Rank 2 · LXL04_022563 · OH-1004

Cell membrane0.061

Rank 3 · LXL04_022563 · OH-1004

Endoplasmic reticulum0.036

Rank 4 · LXL04_022563 · OH-1004

Plastid0.017

Rank 5 · LXL04_022563 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14215.13bHLH-MYC_N53-241 aa

PF00010.32HLH400-446 aa

PF23177.2bHLH_IRO3403-464 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022563	`PF14215.13`	bHLH-MYC_N	53	241	1.7e-51	175.8
LXL04_022563	`PF00010.32`	HLH	400	446	2.9e-12	46.9
LXL04_022563	`PF23177.2`	bHLH_IRO3	403	464	2.4e-09	38.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNJ5`	Arabidopsis thaliana	Transcription factor bHLH13	49.663%	Swiss-Prot	moderate database homology
`Q9ZPY8`	Arabidopsis thaliana	Transcription factor ABA-INDUCIBLE bHLH-TYPE	46.341%	Swiss-Prot	moderate database homology
`O23487`	Arabidopsis thaliana	Transcription factor bHLH3	34.799%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card