Gene Card
Gene overview
cDNA / CDS / Protein Sequences
549 bp · TkA03G532150|TK1151|cDNA
ATGGGGTTCCAATTTGCCGGTAAAGCTGTATACACAGCAGTATGGGTGGCTGTTGTATCACTTTTCATGGAGTTACTTGGTTTTTCTACCCAAAAATGGCTAACTGCAGGAGGCCTTGGGACTGTCTTGCTTACACTTGCTGGTCGTGAGATATTCAGGAATTTTCTGTCAAGTGCAATGATTCATGCAACCCGTCCATTTGTTGTGAATGAGTGGATTAAAGCAAAGATTGAAGGCTATGAAGTTTCTGGAACTGTAGA...
549 bp · TkA03G532150|TK1151|CDS
ATGGGGTTCCAATTTGCCGGTAAAGCTGTATACACAGCAGTATGGGTGGCTGTTGTATCACTTTTCATGGAGTTACTTGGTTTTTCTACCCAAAAATGGCTAACTGCAGGAGGCCTTGGGACTGTCTTGCTTACACTTGCTGGTCGTGAGATATTCAGGAATTTTCTGTCAAGTGCAATGATTCATGCAACCCGTCCATTTGTTGTGAATGAGTGGATTAAAGCAAAGATTGAAGGCTATGAAGTTTCTGGAACTGTAGA...
Protein
Download Protein FASTA182 aa · TkA03G532150|TK1151|PROTEIN
MGFQFAGKAVYTAVWVAVVSLFMELLGFSTQKWLTAGGLGTVLLTLAGREIFRNFLSSAMIHATRPFVVNEWIKAKIEGYEVSGTVEHVGWWSPTVIRGEDREAIHIPNHKFTMNVVRNMTQKTHWRIKTHLAISDLDVNKINSIVADMRKVIAKNPQVEQQRCIEGYFWKMLILKIKLFGF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G532150 |
|---|---|
| TK1151 ID | TkA03G532150 |
| OH-1004 ID | LXL04_028324 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 98.200 |
| Protein coverage (%) | TK1151 89.560 / OH-1004 60.370Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G532150 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:133822794-133823724 (-) | |||||||||
| Description | Similar to MSL2: Mechanosensitive ion channel protein 2, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0010020 chloroplast fission Biological Process GO:0071470 cellular response to osmotic stress Biological Process GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009526 plastid envelope Cellular Component GO:0031969 chloroplast membrane Cellular Component GO:0005216 monoatomic ion channel activity Molecular Function GO:0008381 mechanosensitive monoatomic ion channel activity Molecular Function GO:0042802 identical protein binding Molecular Function | |||||||||
| KEGG gene cross-reference | aae:aq_812 ath:AT1G58200 ath:AT5G10490 ece:Z2437 ecj:JW1323 eco:b1330 ecoc:C3026_07790 ecs:ECs_1912 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25237MSL2_31-49 aaPF00924MS_channel_2nd51-121 aaPF27690UCP004546108-154 aaPF02984Cyclin_C114-166 aaPF24956Msl2-3_C126-166 aaPF25237MSL2_3142-165 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G532150 | PF25237 | MSL2_3 | 1 | 49 | 1.1e-24 | 88.2 |
| TkA03G532150 | PF00924 | MS_channel_2nd | 51 | 121 | 1.1e-11 | 45.4 |
| TkA03G532150 | PF27690 | UCP004546 | 108 | 154 | 0.15 | 12.9 |
| TkA03G532150 | PF02984 | Cyclin_C | 114 | 166 | 0.29 | 11.9 |
| TkA03G532150 | PF24956 | Msl2-3_C | 126 | 166 | 1.9e-16 | 60.7 |
| TkA03G532150 | PF25237 | MSL2_3 | 142 | 165 | 1.1e-24 | 88.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.