TkA03G528600 | RubberDandelionOmics

Gene overview

TkA03G528600

Reference: TK1151 Chr: Chr03 Coordinates: 132859708-132861767 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

863 bp · TkA03G528600|TK1151|cDNA

TCCTAAAGCCCTAAACTATGAAATCAGCCGCCACTCGACTTTCTTCACAAAGGATACGCTCCCGTTTTCGTTTGTGACATTGCACTTGCGCGATTTCCGACTCTTCTTCCGCACCTCCGACGACCTATCCTAAAGTTTGAAATCAGTCACTCGACGCCTTCGACTCCGGCGGAGATTCTACTGCACCTCTGACGCTTTCCGGTGACCGAATGTATGCTTTGATTCTGGCGACACATGTACCTATATCATCTTCAATTTCC...

CDS

Download CDS FASTA

654 bp · TkA03G528600|TK1151|CDS

ATGTATGCTTTGATTCTGGCGACACATGTACCTATATCATCTTCAATTTCCACCTTATTCACGTTATGCTATCATCTTCAATTTCGCATAGTTGTTTCAATATTATTCTCAGTTGGATGTCGTTTTAGCTCCGTCATCAAGCTCCGGTGGCGCTGGATCCCTGATTTATCTGCTGCAAGGAGAAATTGGAAGCGACCTAAATATTCTAGGTTTACTCAACAAGAACTTCCAGCATGCAATCCAATTCTTATTCCAAAATG...

Protein

Download Protein FASTA

217 aa · TkA03G528600|TK1151|PROTEIN

MYALILATHVPISSSISTLFTLCYHLQFRIVVSILFSVGCRFSSVIKLRWRWIPDLSAARRNWKRPKYSRFTQQELPACNPILIPKWVGNIKHVLPDHFIGDLNKADGDGVLSLGLWVHTQNREFQLLNESGLSNSTMQLSKGNYIITGNDVADEDLDAGGNEPVVELNNGTSKNNNQTTIGTSSDSNSSSASENEVKDVRPCSSFSGPKVFILIAK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G528600`
TK1151 ID	TkA03G528600
OH-1004 ID	LXL04_006059
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.400
Protein coverage (%)	TK1151 53.456 / OH-1004 15.962 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G528600

Location Chr03:132859708-132861767 (-)

Description Similar to GTE9: Transcription factor GTE9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54320`	Required for the lipid transport activity of the ALA/ALIS P4-ATPase complex.	No verified direct reference in this release
`At1g79450`	Required for the lipid transport activity of the ALA/ALIS P4-ATPase complex.	No verified direct reference in this release
`At3g12740`	Required for the lipid transport activity of the ALA/ALIS P4- ATPase complex.	The Arabidopsis P4-ATPase ALA3 localizes to the golgi and requires a beta-subunit to function in lipid translocation and secretory vesicle formation.2008 · DOI: 10.1105/tpc.107.054767

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006059 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051365 cellular response to potassium ion starvation Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G73150

ath:AT3G01770

ath:AT3G27260

ath:AT5G14270

ath:AT5G63320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.403

Rank 1 · TkA03G528600 · TK1151

Cytoplasm0.347

Rank 2 · TkA03G528600 · TK1151

Cell membrane0.135

Rank 3 · TkA03G528600 · TK1151

Mitochondrion0.127

Rank 4 · TkA03G528600 · TK1151

Endoplasmic reticulum0.106

Rank 5 · TkA03G528600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30501DUF861916-68 aa

PF25156PNGase_A_C125-149 aa

PF25156PNGase_A_C169-192 aa

PF25706HCMV_UL116172-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G528600	`PF30501`	DUF8619	16	68	0.31	11.2
TkA03G528600	`PF25156`	PNGase_A_C	125	149	1.4	9.7
TkA03G528600	`PF25156`	PNGase_A_C	169	192	1.4	9.7
TkA03G528600	`PF25706`	HCMV_UL116	172	196	0.13	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLK2`	Arabidopsis thaliana	sp\|Q9SLK2\|ALIS3_ARATH ALA-interacting subunit 3	79.400%	Swiss-Prot	Low
`Q8L8W0`	Arabidopsis thaliana	sp\|Q8L8W0\|ALIS5_ARATH ALA-interacting subunit 5	67.600%	Swiss-Prot	Low
`Q9LTW0`	Arabidopsis thaliana	sp\|Q9LTW0\|ALIS1_ARATH ALA-interacting subunit 1	82.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card