TkA03G524700 | RubberDandelionOmics

Gene overview

TkA03G524700

Reference: TK1151 Chr: Chr03 Coordinates: 131692687-131695426 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2225 bp · TkA03G524700|TK1151|cDNA

ATCATGGCGATCTGAGAGAGAAGGGAACACACTATAAATTATTTATTGTTTAGCTACAATTCGAGGCCTTTCTTCGCCTTACACTCTGCCTCCATTGATTTTACTCTCCCGTTACCGGATTCATTTCATAGATTACACTCGAATAAGTCGTCACGGAGCTATTATGGAGATTATGTCGCCGTTAGACTCGATTGATTCGTTGTTGTTCTCCGCCAGCAGAGCCTTGTGTACTCCTTTCGCCGTATTTGTTCAGATCCAGG...

CDS

Download CDS FASTA

564 bp · TkA03G524700|TK1151|CDS

ATGGCAGGGATTGGTCTACATGAAGGAAAGAAACTTGGTTTTGCATCATGCAAACGGAACTCTGGTGCTACAGAAGGCATAAATGTGATGATTGAGAAATGCAAGCCAGATGGAACATGGACATATGGTGTGTCATGTATAGAGTATACCGAGTTTGACAAGTTTGGAATTGCTGATGGATCTTCTTCCATTAATAGAGGTTATTGGATCAATGTGAAAAAAACAATCAACTTCATGGACCAATTCGGGGTCCAACATGG...

Protein

Download Protein FASTA

187 aa · TkA03G524700|TK1151|PROTEIN

MAGIGLHEGKKLGFASCKRNSGATEGINVMIEKCKPDGTWTYGVSCIEYTEFDKFGIADGSSSINRGYWINVKKTINFMDQFGVQHGVAGGRLECTMQNIADNLVNSFSSQCFEDVEEMLDTYIVYNHGRKVTSSAKKQRKPADMSLHQTPDGALLDIIINAMIFFHNVISKSLRYHFWFTIAFTLT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G524700`
TK1151 ID	TkA03G524700
OH-1004 ID	LXL04_012211
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.900
Protein coverage (%)	TK1151 86.631 / OH-1004 22.350 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G524700

Location Chr03:131692687-131695426 (+)

Description Similar to UGP3: UTP--glucose-1-phosphate uridylyltransferase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56040`	Involved in the biosynthesis of sulfolipids in the chloroplast.	A chloroplastic UDP-glucose pyrophosphorylase from Arabidopsis is the committed enzyme for the first step of sulfolipid biosynthesis.2009 · DOI: 10.1105/tpc.108.063925

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012211 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006011 UDP-alpha-D-glucose metabolic process Biological Process

GO:0006048 UDP-N-acetylglucosamine biosynthetic process Biological Process

GO:0009226 nucleotide-sugar biosynthetic process Biological Process

GO:0009555 pollen development Biological Process

GO:0033356 UDP-L-arabinose metabolic process Biological Process

GO:0046398 UDP-glucuronate metabolic process Biological Process

GO:0046506 sulfolipid biosynthetic process Biological Process

GO:0052573 UDP-D-galactose metabolic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0003977 UDP-N-acetylglucosamine diphosphorylase activity Molecular Function

KEGG gene cross-reference

ath:AT3G56040

ath:AT5G52560

cmo:103485690

dosa:Os06g0701200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.400

Rank 1 · TkA03G524700 · TK1151

Nucleus0.374

Rank 2 · TkA03G524700 · TK1151

Mitochondrion0.155

Rank 3 · TkA03G524700 · TK1151

Cell membrane0.109

Rank 4 · TkA03G524700 · TK1151

Extracellular0.083

Rank 5 · TkA03G524700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IY62`	Arabidopsis thaliana	sp\|F4IY62\|UGPA3_ARATH UTP--glucose-1-phosphate uridylyltransferase 3, chloroplastic	54.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card