RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G515900
Reference: TK1151 Chr: Chr03 Coordinates: 129413723-129417485 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2345 bp · TkA03G515900|TK1151|cDNA

CTCATTTGCAGTCACGTCTACAAGACTTTCCCACTCTCTCTCTCTCTCTCTCTCGGAGCCCATTCTCTCTCTAGAGTCTAGATGCTTAAGGTTCTGAAAGTGGAAAGGATTCAGATTACAGAGTGAATTTCAGAGAGAGAACATTCAGTTCGTGAGAGAGAAAGTGCAAGATTGCAAAAGGATTCGAGACGACGATGCTGAGGCCAATATCACTGCACATCTTCCTCCTTGTTTTCCTTGCAGCTTTCACACCTTCTTAC...

CDS

Download CDS FASTA

1887 bp · TkA03G515900|TK1151|CDS

ATGCTGAGGCCAATATCACTGCACATCTTCCTCCTTGTTTTCCTTGCAGCTTTCACACCTTCTTACCAAGCACCATATGCTCTGAGAATAAGCTGTGGAGCTCGCAAAGACGTCCACACAGCACCGACAAATACATTTTGGTACAGAGATTTCGGTTACAGCGGAGGCCAATTAGGTAATGCAACTCGTCCAAGCTACATCACTCCTCCTCTCACCACACTTCGCTACTTCCCTCTATCTGCGGGTCCCGAAAACTGCTA...

Protein

Download Protein FASTA

628 aa · TkA03G515900|TK1151|PROTEIN

MLRPISLHIFLLVFLAAFTPSYQAPYALRISCGARKDVHTAPTNTFWYRDFGYSGGQLGNATRPSYITPPLTTLRYFPLSAGPENCYHIDRVPHGHYSVRVFFALVKDPTFDNEPLFDVSVEGTLVYSLSSGWSNHDDEQAFVEALVFLEDSTASICLHSTGHGDPAILSIEVLQVGNNAYNFGPGWGRGTILRTHKRLSCGAKDPKFDADYSGNHWGGDRFWNSITTFGQNSDKPLTTKTNIKLSPKVPNYYPEALYQT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G515900
TK1151 IDTkA03G515900
OH-1004 IDLXL04_010259
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G515900
LocationChr03:129413723-129417485 (+)
DescriptionSimilar to RLP4: Receptor-like protein 4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g28340 Receptor-like protein 4. No verified direct reference in this release
At1g51820 Probable LRR receptor-like serine/threonine-protein kinase At1g51820. No verified direct reference in this release
At3g21340 Probable receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates. No verified direct reference in this release
At1g51800 Negatively regulates the abscisic acid (ABA) signaling pathway.
An Arabidopsis (malectin-like) leucine-rich repeat receptor-like kinase contributes to downy mildew disease.2011 · DOI: 10.1111/j.1365-3040.2011.02390.x
The receptor kinase IMPAIRED OOMYCETE SUSCEPTIBILITY1 attenuates abscisic acid responses in Arabidopsis.2014 · DOI: 10.1104/pp.114.248518
The Arabidopsis Malectin-Like/LRR-RLK IOS1 Is Critical for BAK1-Dependent and BAK1-Independent Pattern-Triggered Immunity.2016 · DOI: 10.1105/tpc.16.00313
At1g05700 Probable LRR receptor-like serine/threonine-protein kinase At1g05700. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_010259 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007165 signal transduction Biological Process
GO:0042545 cell wall modification Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005768 endosome Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005802 trans-Golgi network Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0016020 membrane Cellular Component
GO:0031252 cell leading edge Cellular Component
GO:0031254 cell trailing edge Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G28340
ath:AT1G51820
ath:AT2G14510
ath:AT3G21340
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.697
Rank 1 · TkA03G515900 · TK1151
Extracellular0.123
Rank 2 · TkA03G515900 · TK1151
Cytoplasm0.099
Rank 3 · TkA03G515900 · TK1151
Endoplasmic reticulum0.094
Rank 4 · TkA03G515900 · TK1151
Lysosome / Vacuole0.059
Rank 5 · TkA03G515900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_211-20 aa
PF12819Malectin_like30-364 aa
PF17829GH115_C76-124 aa
PF11721Malectin92-129 aa
PF11721Malectin203-357 aa
PF17829GH115_C263-323 aa
PF00560LRR_1274-282 aa
PF08263LRRNT_2375-412 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G515900PF08263LRRNT_211200.002119.0
TkA03G515900PF12819Malectin_like303643.2e-52178.6
TkA03G515900PF17829GH115_C761240.2112.1
TkA03G515900PF11721Malectin921295.2e-2072.8
TkA03G515900PF11721Malectin2033575.2e-2072.8
TkA03G515900PF17829GH115_C2633230.2112.1
TkA03G515900PF00560LRR_12742821.6e-1142.7
TkA03G515900PF08263LRRNT_23754120.002119.0
TkA03G515900PF00560LRR_14264441.6e-1142.7
TkA03G515900PF23598LRR_144265001.1e-0525.0
TkA03G515900PF13855LRR_84374807.2e-1555.2
TkA03G515900PF23211LRR_LRWD14425050.01715.5
TkA03G515900PF13516LRR_64444580.09513.5
TkA03G515900PF13855LRR_84465057.2e-1555.2
TkA03G515900PF00560LRR_14464671.6e-1142.7
TkA03G515900PF12799LRR_44464791.1e-0629.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4HWL3Arabidopsis thalianasp|F4HWL3|RLP4_ARATH Receptor-like protein 470.200%Swiss-ProtHigh
C0LGG3Arabidopsis thalianasp|C0LGG3|Y5182_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g5182024.000%Swiss-ProtLow
Q9LIG2Arabidopsis thalianasp|Q9LIG2|RLK6_ARATH Receptor-like protein kinase At3g2134024.700%Swiss-ProtLow
Q9C8I6Arabidopsis thalianasp|Q9C8I6|IOS1_ARATH LRR receptor-like serine/threonine-protein kinase IOS124.800%Swiss-ProtLow
C0LGD6Arabidopsis thalianasp|C0LGD6|Y1570_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g0570026.800%Swiss-ProtLow

JBrowse

View in Genome Browser