TkA03G513450 | RubberDandelionOmics

Gene overview

TkA03G513450

Reference: TK1151 Chr: Chr03 Coordinates: 128799079-128801175 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1329 bp · TkA03G513450|TK1151|cDNA

ATGGATGGCTATTATGTCTCTTTTTTTGGCCTATTTAGTGGAAGACTATTGTGGAATCAGGCTATTGGGTCAAAAACTCAAGAACATATTATATGCCATCTCAACGGCATGTCTGTACAGCAGGCATTGGATGAAAACAAACTCTTCGTATTAGATTACCGCGACATTTACCTCCCATTTTTAGAGAGGATAAATGCTCAAGAAGACCGAAAAGCATATGGAACCCGTACAATCTTCTTCTTGACAACAACAGGAACTCT...

CDS

Download CDS FASTA

1329 bp · TkA03G513450|TK1151|CDS

ATGGATGGCTATTATGTCTCTTTTTTTGGCCTATTTAGTGGAAGACTATTGTGGAATCAGGCTATTGGGTCAAAAACTCAAGAACATATTATATGCCATCTCAACGGCATGTCTGTACAGCAGGCATTGGATGAAAACAAACTCTTCGTATTAGATTACCGCGACATTTACCTCCCATTTTTAGAGAGGATAAATGCTCAAGAAGACCGAAAAGCATATGGAACCCGTACAATCTTCTTCTTGACAACAACAGGAACTCT...

Protein

Download Protein FASTA

442 aa · TkA03G513450|TK1151|PROTEIN

MDGYYVSFFGLFSGRLLWNQAIGSKTQEHIICHLNGMSVQQALDENKLFVLDYRDIYLPFLERINAQEDRKAYGTRTIFFLTTTGTLNPIAIELSLPNNDCKLPSKQVVTPPVDATTNWLWQLAKAHVCSNDTGVHQLIHHWLRVHASMEPFVIAAHRNLSSTSGIIEDGFSSGIYSTEMVCAAYRDWWRFDLEGLPQDLIRRGMAVSDDTSPHGLRLLIEDYLYANDGLLIWSAIQELVHTYDTELQSWYNEAINVGHY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G513450`
TK1151 ID	TkA03G513450
OH-1004 ID	LXL04_010237
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.600
Protein coverage (%)	TK1151 95.023 / OH-1004 95.281 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G513450

Location Chr03:128799079-128801175 (-)

Description Similar to LOX3: Lipoxygenase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17420`	13S-lipoxygenase that can use linolenic acid as substrates.	No verified direct reference in this release
`At1g72520`	Plant lipoxygenases may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0447100`	Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010237 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009625 response to insect Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009901 anther dehiscence Biological Process

KEGG gene cross-reference

ath:AT1G17420

ath:AT1G72520

sot:102597498

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.585

Rank 1 · TkA03G513450 · TK1151

Nucleus0.237

Rank 2 · TkA03G513450 · TK1151

Extracellular0.143

Rank 3 · TkA03G513450 · TK1151

Peroxisome0.074

Rank 4 · TkA03G513450 · TK1151

Mitochondrion0.059

Rank 5 · TkA03G513450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00305Lipoxygenase26-162 aa

PF00305Lipoxygenase163-425 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G513450	`PF00305`	Lipoxygenase	26	162	1.6e-161	539.9
TkA03G513450	`PF00305`	Lipoxygenase	163	425	1.6e-161	539.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNR3`	Arabidopsis thaliana	sp\|Q9LNR3\|LOX3_ARATH Lipoxygenase 3, chloroplastic	59.200%	Swiss-Prot	High
`Q9FNX8`	Arabidopsis thaliana	sp\|Q9FNX8\|LOX4_ARATH Lipoxygenase 4, chloroplastic	57.300%	Swiss-Prot	High
`Q7XV13`	Oryza sativa subsp. japonica	sp\|Q7XV13\|LOX5_ORYSJ Putative lipoxygenase 5	55.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card