TkA03G513170 | RubberDandelionOmics

Gene overview

TkA03G513170

Reference: TK1151 Chr: Chr03 Coordinates: 128735531-128737464 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1161 bp · TkA03G513170|TK1151|cDNA

GCGACCCTAATCCAATTATTTCACATATGCTCTTTCCTCAACCATTCCCTCCAAAGCCAAACACCACAACTCCCCCAAGTTTAGCAAACTCTTGATGCTAAAATCGAAAAAACACACCGGCTTAACATGGGCTCTAGACTACTTCTCGCAACTACTCATTTACCTTTCAATCCTATAGCAGAAAAATCTCAAAAGTTTCCTCAATTCTACACTCCTAATTCACGTCCACGATTTCAGGTTCTATGCTCATTATCAGGGAC...

CDS

Download CDS FASTA

657 bp · TkA03G513170|TK1151|CDS

ATGGGCTCTAGACTACTTCTCGCAACTACTCATTTACCTTTCAATCCTATAGCAGAAAAATCTCAAAAGTTTCCTCAATTCTACACTCCTAATTCACGTCCACGATTTCAGGTTCTATGCTCATTATCAGGGACAATTGGCAACGATGGATCAGTGACTGGTGGTGCTTATGGTTATCGTAAAGCAACAACTTCTCTTACACAGAAATTATTGTCATCCCCGAAGCAAGTGACTCTCGTACGCCATGGCTTAAGCTCTTG...

Protein

Download Protein FASTA

218 aa · TkA03G513170|TK1151|PROTEIN

MGSRLLLATTHLPFNPIAEKSQKFPQFYTPNSRPRFQVLCSLSGTIGNDGSVTGGAYGYRKATTSLTQKLLSSPKQVTLVRHGLSSWNDESRVQGSSNLSILTETGIMQAERCKKALVDIHFDQCFSSPISRAKSTAEILWAGREEPLIFLDTLKEAHLFYLEGMKNVDAKRTYPKEYRMWREDPSNFNVNGVYPVRQIWDTAKIAWREILFTPVSGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G513170`
TK1151 ID	TkA03G513170
OH-1004 ID	LXL04_010232
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.165 / OH-1004 75.887 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G513170

Location Chr03:128735531-128737464 (+)

Description Similar to At5g22620: Probable 2-carboxy-D-arabinitol-1-phosphatase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22620`	Phosphoglycerate mutase-like protein lacking PGM activity, but having 2-carboxy-D-arabinitol 1-phosphate (CA1P) phosphatase activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010232 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0006564 L-serine biosynthetic process Biological Process

GO:0016311 dephosphorylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004619 phosphoglycerate mutase activity Molecular Function

GO:0016791 phosphatase activity Molecular Function

GO:0036424 L-phosphoserine phosphatase activity Molecular Function

GO:0047538 2-carboxy-D-arabinitol-1-phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT3G50520

ath:AT5G22620

eci:UTI89_C5168

hte:Hydth_0104

hth:HTH_0103

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.954

Rank 1 · TkA03G513170 · TK1151

Mitochondrion0.056

Rank 2 · TkA03G513170 · TK1151

Nucleus0.028

Rank 3 · TkA03G513170 · TK1151

Cytoplasm0.021

Rank 4 · TkA03G513170 · TK1151

Cell membrane0.011

Rank 5 · TkA03G513170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00300His_Phos_178-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G513170	`PF00300`	His_Phos_1	78	210	6.8e-27	95.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNJ9`	Arabidopsis thaliana	sp\|Q9FNJ9\|CA1P_ARATH Probable 2-carboxy-D-arabinitol-1-phosphatase	42.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card