Gene Card
Gene overview
cDNA / CDS / Protein Sequences
849 bp · LXL04_010232|LXL04_010232|OH1004|cDNA
ATGGGCTCTAGACTACTTCTCGCAACTACTCATTTACCTTTCAATCCTATAGCAGAAAAATCTCAAAAGTTTCCTCAATTCTACACTCCTAATTCACGTCCACGATTTCAGGTTCTATGCTCATTATCAGGGACAATTGGCAACGATGGATCAGTGACTGGTGGTGCTTATGGTTATCGTAAAGCAACAACTTCTCTTACACAGAAATTATTGTCATCCCCGAAGCAAGTGACTCTCGTACGCCATGGCTTAAGCTCTTG...
849 bp · LXL04_010232|LXL04_010232|OH1004|CDS
ATGGGCTCTAGACTACTTCTCGCAACTACTCATTTACCTTTCAATCCTATAGCAGAAAAATCTCAAAAGTTTCCTCAATTCTACACTCCTAATTCACGTCCACGATTTCAGGTTCTATGCTCATTATCAGGGACAATTGGCAACGATGGATCAGTGACTGGTGGTGCTTATGGTTATCGTAAAGCAACAACTTCTCTTACACAGAAATTATTGTCATCCCCGAAGCAAGTGACTCTCGTACGCCATGGCTTAAGCTCTTG...
Protein
Download Protein FASTA282 aa · LXL04_010232|LXL04_010232|OH1004|PROTEIN
MGSRLLLATTHLPFNPIAEKSQKFPQFYTPNSRPRFQVLCSLSGTIGNDGSVTGGAYGYRKATTSLTQKLLSSPKQVTLVRHGLSSWNDESRVQGSSNLSILTETGIMQAERCKKALVDIHFDQCFSSPISRAKSTAEILWAGREEPLIFLDTLKEAHLFYLEGMKNVDAKRTYPKEYRMWREDPSNFNVNGVYPVRQIWDTAKIAWREILFTPGENFLVVTHKSILRALICTALGLTPERFRAVDVNNGGITVFKVNVE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_010232 |
|---|---|
| TK1151 ID | TkA03G513170 |
| OH-1004 ID | LXL04_010232 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 98.165 / OH-1004 75.887Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_010232 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:142629895-142631559 (+) | |||||||||
| Description | Similar to At5g22620: Probable 2-carboxy-D-arabinitol-1-phosphatase | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006096 glycolytic process Biological Process GO:0006564 L-serine biosynthetic process Biological Process GO:0016311 dephosphorylation Biological Process GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0004619 phosphoglycerate mutase activity Molecular Function GO:0016791 phosphatase activity Molecular Function GO:0036424 L-phosphoserine phosphatase activity Molecular Function GO:0047538 2-carboxy-D-arabinitol-1-phosphatase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G50520 ath:AT5G22620 eci:UTI89_C5168 hte:Hydth_0104 hth:HTH_0103 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00300.28His_Phos_178-264 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_010232 | PF00300.28 | His_Phos_1 | 78 | 264 | 7e-40 | 137.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.