TkA03G502760 | RubberDandelionOmics

Gene overview

TkA03G502760

Reference: TK1151 Chr: Chr03 Coordinates: 126227273-126228206 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

744 bp · TkA03G502760|TK1151|cDNA

CTTTCCTGAAGAGGAAATCCGAATGAGAAGTCATGAAATGCTTGAAAACGAAGACATGCAGCATTTGCTTCGGTTATTCAACATGGGTGCTGGTCAAAGTCAAGGTCAAAGTCAAACCCATGGTCAAACCTCTGGTGGTGGACATGTGAACGAAAGTTATTATCCGTATTCTAGTGGTTATGTGCCAAATACGCCCTCGAGTTTTGGGTATGGATTTGATGTGGATAAGACAAGGAGTTCAGGGAAGGCGGTGGTGGGGT...

CDS

Download CDS FASTA

333 bp · TkA03G502760|TK1151|CDS

ATGAGAAGTCATGAAATGCTTGAAAACGAAGACATGCAGCATTTGCTTCGGTTATTCAACATGGGTGCTGGTCAAAGTCAAGGTCAAAGTCAAACCCATGGTCAAACCTCTGGTGGTGGACATGTGAACGAAAGTTATTATCCGTATTCTAGTGGTTATGTGCCAAATACGCCCTCGAGTTTTGGGTATGGATTTGATGTGGATAAGACAAGGAGTTCAGGGAAGGCGGTGGTGGGGTGGCTTAAATTGAAGGCGGCTTT...

Protein

Download Protein FASTA

110 aa · TkA03G502760|TK1151|PROTEIN

MRSHEMLENEDMQHLLRLFNMGAGQSQGQSQTHGQTSGGGHVNESYYPYSSGYVPNTPSSFGYGFDVDKTRSSGKAVVGWLKLKAALRWGIFIRKQAAERRAQIVEIEDP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G502760`
TK1151 ID	TkA03G502760
OH-1004 ID	LXL04_010147
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 17.799 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G502760

Location Chr03:126227273-126228206 (-)

Description Similar to CBP60B: Calmodulin-binding protein 60 B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57580`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release
`At2g24300`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release
`At4g31000`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release
`At4g25800`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release
`At2g18750`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010147 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0080142 regulation of salicylic acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G18750

ath:AT2G24300

ath:AT4G25800

ath:AT4G31000

ath:AT5G57580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.497

Rank 1 · TkA03G502760 · TK1151

Cytoplasm0.344

Rank 2 · TkA03G502760 · TK1151

Cell membrane0.154

Rank 3 · TkA03G502760 · TK1151

Endoplasmic reticulum0.113

Rank 4 · TkA03G502760 · TK1151

Mitochondrion0.072

Rank 5 · TkA03G502760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKL6`	Arabidopsis thaliana	sp\|Q9FKL6\|CB60B_ARATH Calmodulin-binding protein 60 B	50.500%	Swiss-Prot	High
`F4IPM3`	Arabidopsis thaliana	sp\|F4IPM3\|CB60E_ARATH Calmodulin-binding protein 60 E	52.800%	Swiss-Prot	High
`F4JR57`	Arabidopsis thaliana	sp\|F4JR57\|CB60F_ARATH Calmodulin-binding protein 60 F	49.500%	Swiss-Prot	Medium
`Q0WVV6`	Arabidopsis thaliana	sp\|Q0WVV6\|CB60D_ARATH Calmodulin-binding protein 60 D	48.600%	Swiss-Prot	Medium
`C0SV51`	Arabidopsis thaliana	sp\|C0SV51\|CB60C_ARATH Calmodulin-binding protein 60 C	49.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card