TkA03G501250 | RubberDandelionOmics

Gene overview

TkA03G501250

Reference: TK1151 Chr: Chr03 Coordinates: 125851370-125851935 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · TkA03G501250|TK1151|cDNA

TACTCATGTGATGTTGGCTATGAACGATTTCTTGGTCCCGAGATTTTCTTTAATCCAGAGATATACAATAAAGACTTCACAACCCCTTTACCTGCTGTAATAGACAGGTGTATTCAGTCTGCACCAATTGACACAAGAAGAGCACTATATAAGAATATAGTGTTGTCTGGAGGATCGACCATGTTTAAAGATTTCCAAAGAAGGCTGCAACGTGACACCAAGAAGATTGTGGATGCACGTGTTCATGCATCTAGTGCAAG...

CDS

Download CDS FASTA

345 bp · TkA03G501250|TK1151|CDS

TACTCATGTGATGTTGGCTATGAACGATTTCTTGGTCCCGAGATTTTCTTTAATCCAGAGATATACAATAAAGACTTCACAACCCCTTTACCTGCTGTAATAGACAGGTGTATTCAGTCTGCACCAATTGACACAAGAAGAGCACTATATAAGAATATAGTGTTGTCTGGAGGATCGACCATGTTTAAAGATTTCCAAAGAAGGCTGCAACGTGACACCAAGAAGATTGTGGATGCACGTGTTCATGCATCTAGTGCAAG...

Protein

Download Protein FASTA

115 aa · TkA03G501250|TK1151|PROTEIN

YSCDVGYERFLGPEIFFNPEIYNKDFTTPLPAVIDRCIQSAPIDTRRALYKNIVLSGGSTMFKDFQRRLQRDTKKIVDARVHASSARHGSEVKAQPVEVNVVSHPIQRYAVWFGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G501250`
TK1151 ID	TkA03G501250
OH-1004 ID	LXL04_011644
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 26.682 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G501250

Location Chr03:125851370-125851935 (+)

Description Similar to ARP3: Actin-related protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13180`	Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.	Requirements for Arabidopsis ATARP2 and ATARP3 during epidermal development.2003 · DOI: 10.1016/s0960-9822(03)00493-7

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X6S3`	Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.	No verified direct reference in this release
`Os02g0596900`	Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011644 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0006887 exocytosis Biological Process

GO:0006909 phagocytosis Biological Process

GO:0007015 actin filament organization Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0030041 actin filament polymerization Biological Process

GO:0034314 Arp2/3 complex-mediated actin nucleation Biological Process

GO:0045010 actin nucleation Biological Process

GO:0046689 response to mercury ion Biological Process

GO:0001891 phagocytic cup Cellular Component

KEGG gene cross-reference

ath:AT1G13180

ddi:DDB_G0283755

dosa:Os02g0596900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.677

Rank 1 · TkA03G501250 · TK1151

Cytoplasm0.398

Rank 2 · TkA03G501250 · TK1151

Cell membrane0.052

Rank 3 · TkA03G501250 · TK1151

Mitochondrion0.026

Rank 4 · TkA03G501250 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkA03G501250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00022Actin3-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G501250	`PF00022`	Actin	3	115	6.8e-17	61.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAF1`	Arabidopsis thaliana	sp\|Q9SAF1\|ARP3_ARATH Actin-related protein 3	79.100%	Swiss-Prot	High
`A2X6S3`	Oryza sativa subsp. indica	sp\|A2X6S3\|ARP3_ORYSI Actin-related protein 3	85.200%	Swiss-Prot	High
`Q6K908`	Oryza sativa subsp. japonica	sp\|Q6K908\|ARP3_ORYSJ Actin-related protein 3	85.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card