TkA03G497800 | RubberDandelionOmics

Gene overview

TkA03G497800

Reference: TK1151 Chr: Chr03 Coordinates: 124902032-124910431 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1684 bp · TkA03G497800|TK1151|cDNA

TAATTCTAGACTTACATCCTAAGTCGGCAAATTAAATACCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCACATACAAACATCATCCGCATATGACATGCATCACCTTTGTCTCAAATGCGGTTCAAATCAATCTTTGGGGAAATTAACAAGGAAACAATAACGTTTTCATCGACGACGAAAGAACAAGAAACATTTCCATACAAACTTCCCTTGTCAATTTGCCTTTAGTATTTTTCTTAATCCTTCGTTTTTCC...

CDS

Download CDS FASTA

576 bp · TkA03G497800|TK1151|CDS

ATGGGTGGCCTCACTAGCCTCAGCACGACGATGGAACAGTTTGCCACCATGGTTTCAAATTTAGCAGAAAATCTAGCAGAGATTCTGGCTGAGCAACTGGGCCATAAGTCTGATTTTTTCAAGCAAAATTGTTTGCCTAGCACATGTTACCTCCGTATGAACAGATATCCACCGTGCCCCATTTCTTCACAAGTCTTTGGATTGATGCCACATACCGATAGTGATTTTCTCACTATATTACATCAAGATCAAATTGGAGG...

Protein

Download Protein FASTA

191 aa · TkA03G497800|TK1151|PROTEIN

MGGLTSLSTTMEQFATMVSNLAENLAEILAEQLGHKSDFFKQNCLPSTCYLRMNRYPPCPISSQVFGLMPHTDSDFLTILHQDQIGGLQLVKDGKWIAVKPNKEALIINIGDLFQAWSNDVYKSVEHRVVAHKQTERFSTAYFFCPSYDTVIQSGVEDSIYRRFSFKEFRQQVQDDVKRLGYKIGLPRFII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G497800`
TK1151 ID	TkA03G497800
OH-1004 ID	LXL04_022418
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	57.300
Protein coverage (%)	TK1151 99.476 / OH-1004 56.305 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G497800

Location Chr03:124902032-124910431 (+)

Description Similar to GA2OX6: Gibberellin 2-beta-dioxygenase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21200`	Catalyzes the 2-beta-hydroxylation of gibberellins (GA) precursors, rendering them unable to be converted to active GAs.	Overexpression of a novel class of gibberellin 2-oxidases decreases gibberellin levels and creates dwarf plants.2003 · DOI: 10.1105/tpc.005975
`At1g50960`	Catalyzes the 2-beta-hydroxylation of gibberellins (GA) precursors, rendering them unable to be converted to active GAs.	Overexpression of a novel class of gibberellin 2-oxidases decreases gibberellin levels and creates dwarf plants.2003 · DOI: 10.1105/tpc.005975

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0522500`	Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level.	Activation of gibberellin 2-oxidase 6 decreases active gibberellin levels and creates a dominant semi-dwarf phenotype in rice (Oryza sativa L.).2010 · DOI: 10.1016/s1673-8527(09)60022-9
`Os07g0103500`	Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins (GAs), leading to the homeostatic regulation of their endogenous level.	OsGA2ox5, a gibberellin metabolism enzyme, is involved in plant growth, the root gravity response and salt stress.2014 · DOI: 10.1371/journal.pone.0087110

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022418 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009685 gibberellin metabolic process Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0010336 gibberellic acid homeostasis Biological Process

GO:0045487 gibberellin catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0045543 gibberellin 2-beta-dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G50960

ath:AT4G21200

dosa:Os04g0522500

dosa:Os07g0103500

osa:4336431

osa:4342182

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.788

Rank 1 · TkA03G497800 · TK1151

Nucleus0.285

Rank 2 · TkA03G497800 · TK1151

Peroxisome0.077

Rank 3 · TkA03G497800 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA03G497800 · TK1151

Mitochondrion0.044

Rank 5 · TkA03G497800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF031712OG-FeII_Oxy49-146 aa

PF28464DUF8405128-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G497800	`PF03171`	2OG-FeII_Oxy	49	146	3.3e-33	114.7
TkA03G497800	`PF28464`	DUF8405	128	164	0.011	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49561`	Arabidopsis thaliana	sp\|O49561\|G2OX8_ARATH Gibberellin 2-beta-dioxygenase 8	66.100%	Swiss-Prot	High
`Q9C6I4`	Arabidopsis thaliana	sp\|Q9C6I4\|G2OX7_ARATH Gibberellin 2-beta-dioxygenase 7	46.200%	Swiss-Prot	Medium
`Q7XP65`	Oryza sativa subsp. japonica	sp\|Q7XP65\|G2OX6_ORYSJ Gibberellin 2-beta-dioxygenase 6	51.300%	Swiss-Prot	High
`Q8LGZ9`	Oryza sativa subsp. japonica	sp\|Q8LGZ9\|G2OX5_ORYSJ Gibberellin 2-beta-dioxygenase 5	60.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card