TkA03G494020 | RubberDandelionOmics

Gene overview

TkA03G494020

Reference: TK1151 Chr: Chr03 Coordinates: 123907920-123912967 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1657 bp · TkA03G494020|TK1151|cDNA

TAGAATTTCAAGTTTCACTACAACCGTTAAACCATCTAACGTACTTTTCTTTGTTTTTTGTTGCAGCTTGGTATGGGAAGTGCAGTGGAGACTCTCTGCGGGCAAGCATACGGAGCTCAACAATACGAAATGCTTGGCATTTACCTCCAAAGATCCACCATCCTTCTAATGGCGACCGCCATTCCCCTAATGTTTCTCTACATCTTCTCCAAATTCCTCCTCCTCCTAATCGGCCAATCCAAAGAAATCGCCACGGCAGC...

CDS

Download CDS FASTA

1197 bp · TkA03G494020|TK1151|CDS

ATGGGAAGTGCAGTGGAGACTCTCTGCGGGCAAGCATACGGAGCTCAACAATACGAAATGCTTGGCATTTACCTCCAAAGATCCACCATCCTTCTAATGGCGACCGCCATTCCCCTAATGTTTCTCTACATCTTCTCCAAATTCCTCCTCCTCCTAATCGGCCAATCCAAAGAAATCGCCACGGCAGCCTCCCTCTTCATCTACGGCCTCATCCCCCAAATCTTCGCATACGCCGCCAATTTCCCAATCCAAAAATTCCT...

Protein

Download Protein FASTA

398 aa · TkA03G494020|TK1151|PROTEIN

MGSAVETLCGQAYGAQQYEMLGIYLQRSTILLMATAIPLMFLYIFSKFLLLLIGQSKEIATAASLFIYGLIPQIFAYAANFPIQKFLQAQSIVNPSAYIAAVMLVFHVILTYLALYVWGWGLLGGSMVLSFSWWAIVVAQFVYIVKSDRTKETWTGFSTQAFSGLWAFLKLSTASAVMLCLETWYFQILILIAGLLPDPEIALDSLAVCGTILGWVLMIAIGFNAAASVRVSNELGAGHPKSAKFAVVVVTLSSFVVALI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G494020`
TK1151 ID	TkA03G494020
OH-1004 ID	LXL04_010062
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.700
Protein coverage (%)	TK1151 100.000 / OH-1004 77.734 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G494020

Location Chr03:123907920-123912967 (-)

Description Similar to DTX40: Protein DETOXIFICATION 40

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21690`	Protein DETOXIFICATION 40.	No verified direct reference in this release
`At1g61890`	Protein DETOXIFICATION 37.	No verified direct reference in this release
`At1g11670`	Protein DETOXIFICATION 36.	No verified direct reference in this release
`At4g21903`	Protein DETOXIFICATION 38.	No verified direct reference in this release
`At4g21910`	Protein DETOXIFICATION 39.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010062 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

GO:0042910 xenobiotic transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G11670

ath:AT1G61890

ath:AT3G21690

ath:AT4G21903

ath:AT4G21910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.383

Rank 1 · TkA03G494020 · TK1151

Lysosome / Vacuole0.369

Rank 2 · TkA03G494020 · TK1151

Endoplasmic reticulum0.101

Rank 3 · TkA03G494020 · TK1151

Cytoplasm0.086

Rank 4 · TkA03G494020 · TK1151

Golgi apparatus0.084

Rank 5 · TkA03G494020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554MatE1-113 aa

PF01554MatE175-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G494020	`PF01554`	MatE	1	113	2.8e-55	187.1
TkA03G494020	`PF01554`	MatE	175	336	2.8e-55	187.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVD9`	Arabidopsis thaliana	sp\|Q9LVD9\|DTX40_ARATH Protein DETOXIFICATION 40	68.400%	Swiss-Prot	High
`O80695`	Arabidopsis thaliana	sp\|O80695\|DTX37_ARATH Protein DETOXIFICATION 37	63.600%	Swiss-Prot	High
`Q9SAB0`	Arabidopsis thaliana	sp\|Q9SAB0\|DTX36_ARATH Protein DETOXIFICATION 36	63.700%	Swiss-Prot	High
`F4JKB9`	Arabidopsis thaliana	sp\|F4JKB9\|DTX38_ARATH Protein DETOXIFICATION 38	59.200%	Swiss-Prot	High
`Q940N9`	Arabidopsis thaliana	sp\|Q940N9\|DTX39_ARATH Protein DETOXIFICATION 39	58.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card