Gene Card
Gene overview
cDNA / CDS / Protein Sequences
339 bp · TkA03G491960|TK1151|cDNA
ATGTCCGAGAAATGCCGAGCAGGCATTTCATCGAGCACCTGGTGTGCACCGGTGATGCCGAGAAAAATTGGTCGCGACCAGCATCTGTCCGGGAATGGTCGAGTGACATTTCGTCGAGCACCTGGTGTGCTTGAATGTTGCTCGGGCAAATGTGGTCGCGGCCGAGTAAGCATTTGGTCGAACAGGTGGTGTGCACGGGGTGTTGCTCGGGCAAACGTGGTCGCGGCTGGTTTTGTCCGGGAATGGCCGAGTCCGATCGG...
339 bp · TkA03G491960|TK1151|CDS
ATGTCCGAGAAATGCCGAGCAGGCATTTCATCGAGCACCTGGTGTGCACCGGTGATGCCGAGAAAAATTGGTCGCGACCAGCATCTGTCCGGGAATGGTCGAGTGACATTTCGTCGAGCACCTGGTGTGCTTGAATGTTGCTCGGGCAAATGTGGTCGCGGCCGAGTAAGCATTTGGTCGAACAGGTGGTGTGCACGGGGTGTTGCTCGGGCAAACGTGGTCGCGGCTGGTTTTGTCCGGGAATGGCCGAGTCCGATCGG...
Protein
Download Protein FASTA112 aa · TkA03G491960|TK1151|PROTEIN
MSEKCRAGISSSTWCAPVMPRKIGRDQHLSGNGRVTFRRAPGVLECCSGKCGRGRVSIWSNRWCARGVARANVVAAGFVREWPSPIGDRGVPSRHFIEHLVCIILFLFYFLF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G491960 |
|---|---|
| TK1151 ID | TkA03G491960 |
| OH-1004 ID | LXL04_017852 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 69.000 |
| Protein coverage (%) | TK1151 25.893 / OH-1004 11.284Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G491960 |
|---|---|
| Location | Chr03:123346581-123356672 (-) |
| Description | Similar to EXO1: Exonuclease 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0006886 intracellular protein transport Biological Process GO:0090110 COPII-coated vesicle cargo loading Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0030127 COPII vesicle coat Cellular Component GO:0070971 endoplasmic reticulum exit site Cellular Component GO:0003677 DNA binding Molecular Function GO:0005096 GTPase activator activity Molecular Function |
| KEGG gene cross-reference | ath:AT1G05520 ath:AT1G29630 ath:AT3G23660 ath:AT4G14160 dosa:Os01g0777300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.