LXL04_017852 | RubberDandelionOmics

Gene overview

LXL04_017852

Reference: OH-1004 Chr: Chr04 Coordinates: 2359119-2366184 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

774 bp · LXL04_017852|LXL04_017852|OH1004|cDNA

ATGGCCGAGAAATGCCGATcagacatttcatcgagcacctggtgtgcaccgGTGACGCCGAGCAAAATGGGTCGCGATCCGAGAATGGCCGAGGAatgccgagcaggcattaggTCAAATAGGTGGTGTGCGTCAGTGATGTCCGAGGAACTTGGTCGCGATTCGAGAATGGCCGAGGAATGCCGAGTTGGGGTAGCTGAGATGAAAGTTGTGATTGAAAGGACAGGTGGACTTGTTGTTTTAGCTGAAAGTTTTGGTCG...

CDS

Download CDS FASTA

774 bp · LXL04_017852|LXL04_017852|OH1004|CDS

ATGGCCGAGAAATGCCGATCAGACATTTCATCGAGCACCTGGTGTGCACCGGTGACGCCGAGCAAAATGGGTCGCGATCCGAGAATGGCCGAGGAATGCCGAGCAGGCATTAGGTCAAATAGGTGGTGTGCGTCAGTGATGTCCGAGGAACTTGGTCGCGATTCGAGAATGGCCGAGGAATGCCGAGTTGGGGTAGCTGAGATGAAAGTTGTGATTGAAAGGACAGGTGGACTTGTTGTTTTAGCTGAAAGTTTTGGTCG...

Protein

Download Protein FASTA

257 aa · LXL04_017852|LXL04_017852|OH1004|PROTEIN

MAEKCRSDISSSTWCAPVTPSKMGRDPRMAEECRAGIRSNRWCASVMSEELGRDSRMAEECRVGVAEMKVVIERTGGLVVLAESFGRSVFKDSFRRVFKKGEESLGLSHNGTLEINCREHNDWTGEHKDDMFLGNIKMHVDYCMHRVNLLRHFGIKLILVFDGGQGRKILHVLLSMKNLETHQQLMNVIKKTIDISPTIAYELIQVLKQENISYVVAPYEADAKMTFLALRKHVDAVITDDSNLIPFGCPRVSSKFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017852`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017852

Location Chr04:2359119-2366184 (+)

Description Similar to EXO1: Exonuclease 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29630`	Putative 5'->3' double-stranded DNA exonuclease which may also contain a cryptic 3'->5' double-stranded DNA exonuclease activity.	No verified direct reference in this release
`At1g05520`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER) (By similarity).	No verified direct reference in this release
`At4g14160`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER).	No verified direct reference in this release
`At3g23660`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0777300`	Putative 5'->3' double-stranded DNA exonuclease which may also contain a cryptic 3'->5' double-stranded DNA exonuclease activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017852 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0090110 COPII-coated vesicle cargo loading Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0030127 COPII vesicle coat Cellular Component

GO:0070971 endoplasmic reticulum exit site Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0005096 GTPase activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G05520

ath:AT1G29630

ath:AT3G23660

ath:AT4G14160

dosa:Os01g0777300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.435

Rank 1 · LXL04_017852 · OH-1004

Nucleus0.300

Rank 2 · LXL04_017852 · OH-1004

Mitochondrion0.116

Rank 3 · LXL04_017852 · OH-1004

Endoplasmic reticulum0.088

Rank 4 · LXL04_017852 · OH-1004

Cell membrane0.077

Rank 5 · LXL04_017852 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00867.24XPG_I211-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017852	`PF00867.24`	XPG_I	211	256	1.3e-12	48.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L6Z7`	Arabidopsis thaliana	Exonuclease 1	52.239%	Swiss-Prot	weak database homology
`Q8H0S3`	Arabidopsis thaliana	Protein transport protein SEC23 B	78.571%	Swiss-Prot	weak database homology
`Q8VXX0`	Arabidopsis thaliana	Protein transport protein SEC23 F	76.786%	Swiss-Prot	weak database homology
`Q9LUG1`	Arabidopsis thaliana	Protein transport protein SEC23 E	72.414%	Swiss-Prot	weak database homology
`Q60GC1`	Oryza sativa subsp. japonica	Exonuclease 1	56.250%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card