TkA03G489370 | RubberDandelionOmics

Gene overview

TkA03G489370

Reference: TK1151 Chr: Chr03 Coordinates: 122673331-122673879 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA03G489370|TK1151|cDNA

CTTTGAACAAAGATTCATGATGCTATATAAACGATTTCAAGTTTGTGTCAATTCCCTCACATCATTTGGCTCAAGAAAATGTCTCTTAATCGGAGAGATATTGCACAAATATTGGAGATGGAAAGTATCTCTGCTAATCAGGATAACGAGTTTACCGTCTTAGCAAAGATAGTACAACTCGATCATGGTTCTGGATGGTGTAATACTTCATGCAGTAAATGCAACAAGAATTTGGACGCCATCGATGGTTCATTTGTTTG...

CDS

Download CDS FASTA

333 bp · TkA03G489370|TK1151|CDS

ATGTCTCTTAATCGGAGAGATATTGCACAAATATTGGAGATGGAAAGTATCTCTGCTAATCAGGATAACGAGTTTACCGTCTTAGCAAAGATAGTACAACTCGATCATGGTTCTGGATGGTGTAATACTTCATGCAGTAAATGCAACAAGAATTTGGACGCCATCGATGGTTCATTTGTTTGCCCCATCTGCAATCAAGAATGTCGTTATCCCATCATAAGGTATAAAATACATGTGCATGTTATTGACGAAAGTGGGAG...

Protein

Download Protein FASTA

111 aa · TkA03G489370|TK1151|PROTEIN

MSLNRRDIAQILEMESISANQDNEFTVLAKIVQLDHGSGWCNTSCSKCNKNLDAIDGSFVCPICNQECRYPIIRYKIHVHVIDESGSTTFVIFNQEVGKLLDSCVNKFVNR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G489370`
TK1151 ID	TkA03G489370
OH-1004 ID	LXL04_015422
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.500
Protein coverage (%)	TK1151 100.000 / OH-1004 27.053 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G489370`
Location	Chr03:122673331-122673879 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015422` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006260 DNA replication Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0005634 nucleus Cellular Component GO:0005662 DNA replication factor A complex Cellular Component GO:0003684 damaged DNA binding Molecular Function GO:0004386 helicase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016787 hydrolase activity Molecular Function
KEGG gene cross-reference	ath:AT5G61000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.936

Rank 1 · TkA03G489370 · TK1151

Cytoplasm0.157

Rank 2 · TkA03G489370 · TK1151

Cell membrane0.019

Rank 3 · TkA03G489370 · TK1151

Mitochondrion0.014

Rank 4 · TkA03G489370 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA03G489370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17244CDC24_OB315-89 aa

PF27511ComFA_N20-70 aa

PF08646Rep_fac-A_C25-102 aa

PF14951DUF450327-89 aa

PF29625FliZ_N42-56 aa

PF13920zf-C3HC4_343-68 aa

PF18439zf_UBZ44-52 aa

PF03966Trm112p45-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G489370	`PF17244`	CDC24_OB3	15	89	0.059	13.9
TkA03G489370	`PF27511`	ComFA_N	20	70	0.021	15.9
TkA03G489370	`PF08646`	Rep_fac-A_C	25	102	3.1e-09	37.5
TkA03G489370	`PF14951`	DUF4503	27	89	0.023	13.9
TkA03G489370	`PF29625`	FliZ_N	42	56	0.26	11.9
TkA03G489370	`PF13920`	zf-C3HC4_3	43	68	0.21	12.1
TkA03G489370	`PF18439`	zf_UBZ	44	52	0.6	10.5
TkA03G489370	`PF03966`	Trm112p	45	72	0.54	10.9
TkA03G489370	`PF18439`	zf_UBZ	58	67	0.6	10.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card