TkA03G488850 | RubberDandelionOmics

Gene overview

TkA03G488850

Reference: TK1151 Chr: Chr03 Coordinates: 122346870-122352437 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1118 bp · TkA03G488850|TK1151|cDNA

TAAATTTATTTTTTTATTTTTTGTAATCTAGGTTGCCTCCCAGAAATTGACACTAAAAAAGGTGACAAGCTACATAGCAGATGTGATTTGCAAACGTGCAGATCTTGGTTACAACTATGGTGTCATACTCATCCCCGAAGGACTCATCGATTTCATCCCTGAGGTGCAACAGCTTATCTCTGAACTGAATGAGATATTGGCACATGAGACAGTCGATGAAGAGGGCGTTTGGAAACAAAACTTGTCCCTCAGTCTTTACA...

CDS

Download CDS FASTA

864 bp · TkA03G488850|TK1151|CDS

ATGTTTGATTACTTGCAAGAACGTTGCAAAGGAAGTACACTATACGGATTCAAGGGTGGACCAGCTGGAATCATGAAGGGAAAATACATTGTCTTAACCCCTGAGTTTATTTATCCATACAGAAATCAGGGAGGATTTGATATGATCTGTAGTGGGAGGGACAAGATTGAGACTCCAGAACAGTTTAAGCAAGCTGAAGACACAGCAGCCAGGCTGGATCTTGATGGGCTTGTTGTTATTGGTGGAGATGATTCAAACAC...

Protein

Download Protein FASTA

287 aa · TkA03G488850|TK1151|PROTEIN

MFDYLQERCKGSTLYGFKGGPAGIMKGKYIVLTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEDTAARLDLDGLVVIGGDDSNTNACLLAEYFRSKNLKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYAEQIGNVMIDARSTGKYYHFVRLMGRAASHITLECALQTHPNITLIGEEVASQKLTLKKVTSYIADVICKRADLGYNYGVILIPEGLIDFIPEVQQLISELNEILAHETVDEEGVWKQNLSLSLYS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G488850`
TK1151 ID	TkA03G488850
OH-1004 ID	LXL04_009993
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 91.289 / OH-1004 46.903 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G488850

Location Chr03:122346870-122352437 (-)

Description Similar to PFP-BETA: Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12000`	Catalytic subunit of pyrophosphate--fructose 6-phosphate 1-phosphotransferase.	No verified direct reference in this release
`At4g04040`	Catalytic subunit of pyrophosphate--fructose 6-phosphate 1-phosphotransferase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009993 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006002 fructose 6-phosphate metabolic process Biological Process

GO:0009749 response to glucose Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0015979 photosynthesis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003872 6-phosphofructokinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0047334 diphosphate-fructose-6-phosphate 1-phosphotransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G12000

ath:AT4G04040

sot:102577862

sta:STHERM_c17480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.584

Rank 1 · TkA03G488850 · TK1151

Nucleus0.352

Rank 2 · TkA03G488850 · TK1151

Mitochondrion0.170

Rank 3 · TkA03G488850 · TK1151

Cell membrane0.106

Rank 4 · TkA03G488850 · TK1151

Endoplasmic reticulum0.104

Rank 5 · TkA03G488850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00365PFK10-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G488850	`PF00365`	PFK	10	234	1.8e-29	103.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4M5`	Arabidopsis thaliana	sp\|Q8W4M5\|PFPB1_ARATH Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1	84.500%	Swiss-Prot	High
`F4JGR5`	Arabidopsis thaliana	sp\|F4JGR5\|PFPB2_ARATH Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 2	81.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card