LXL04_009993 | RubberDandelionOmics

Gene overview

LXL04_009993

Reference: OH-1004 Chr: Chr02 Coordinates: 137549839-137555010 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1698 bp · LXL04_009993|LXL04_009993|OH1004|cDNA

ATGGCGCCACCATCTATGGTTTCTAATGGCGCTGATGTAGCGGCCGGAAAGTCGGCAGTGAGTAGCCGTGCTTCGTCCGTGTACAGTGAAGTACAGAACAGCCGTCTTGACCATCCGCTTGCTTTACCATCCGTTTTCCAAAAGCCGTTCAAAGTTGTCAACGGCCCTGAGAGCTCCGCCGCTGGAAATCCAGATGAAATTGCAAAGCTTTTCCCATCTCTATTTGGGCAACCTTCAGCAGTGTTGAAGCCAAGTGAATC...

CDS

Download CDS FASTA

1698 bp · LXL04_009993|LXL04_009993|OH1004|CDS

ATGGCGCCACCATCTATGGTTTCTAATGGCGCTGATGTAGCGGCCGGAAAGTCGGCAGTGAGTAGCCGTGCTTCGTCCGTGTACAGTGAAGTACAGAACAGCCGTCTTGACCATCCGCTTGCTTTACCATCCGTTTTCCAAAAGCCGTTCAAAGTTGTCAACGGCCCTGAGAGCTCCGCCGCTGGAAATCCAGATGAAATTGCAAAGCTTTTCCCATCTCTATTTGGGCAACCTTCAGCAGTGTTGAAGCCAAGTGAATC...

Protein

Download Protein FASTA

565 aa · LXL04_009993|LXL04_009993|OH1004|PROTEIN

MAPPSMVSNGADVAAGKSAVSSRASSVYSEVQNSRLDHPLALPSVFQKPFKVVNGPESSAAGNPDEIAKLFPSLFGQPSAVLKPSESNDPAVALKIGVVLSGGQAPGGHNVISGMFDYLQERCKGSTLYGFKGGPAGIMKGKYIVLTPEFIYPYRNQGGFDMICSGRDKIETPEQFKQAEDTAARLDLDGLVVIGGDDSNTNACLLAEYFRSKNLKTRVIGCPKTIDGDLKCKEVPTSFGFDTACKIYAEQIGNVMIDAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009993`
TK1151 ID	TkA03G488850
OH-1004 ID	LXL04_009993
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 91.289 / OH-1004 46.903 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009993

Location Chr02:137549839-137555010 (-)

Description Similar to PFP-BETA: Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12000`	Catalytic subunit of pyrophosphate--fructose 6-phosphate 1-phosphotransferase.	No verified direct reference in this release
`At4g04040`	Catalytic subunit of pyrophosphate--fructose 6-phosphate 1-phosphotransferase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009993 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006002 fructose 6-phosphate metabolic process Biological Process

GO:0009749 response to glucose Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0015979 photosynthesis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003872 6-phosphofructokinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0047334 diphosphate-fructose-6-phosphate 1-phosphotransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G12000

ath:AT4G04040

sot:102577862

sta:STHERM_c17480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.616

Rank 1 · LXL04_009993 · OH-1004

Nucleus0.237

Rank 2 · LXL04_009993 · OH-1004

Cell membrane0.154

Rank 3 · LXL04_009993 · OH-1004

Mitochondrion0.129

Rank 4 · LXL04_009993 · OH-1004

Endoplasmic reticulum0.128

Rank 5 · LXL04_009993 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00365.26PFK95-457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009993	`PF00365.26`	PFK	95	457	5.4e-35	121.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4M5`	Arabidopsis thaliana	Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 1	80.035%	Swiss-Prot	strong database homology
`F4JGR5`	Arabidopsis thaliana	Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta 2	78.750%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card