TkA03G487810 | RubberDandelionOmics

Gene overview

TkA03G487810

Reference: TK1151 Chr: Chr03 Coordinates: 122071266-122077527 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2036 bp · TkA03G487810|TK1151|cDNA

AAAAAACCAAGGGGTAGAGATTGTCTCTTTTTATCCTACGAGGTCTATCTTGGGTACACCACAACATATCTTGTGAGAGACACGCATGTATCCACATTATACAGATGAGGCCACGTAACCGATTAATCCGACGATCATAATTGAAATGCGTAATGGGTTGCGTCCGCTATATATACACACTCACTCTCTTTATATTTTTTCTCTAAATTCATCTCTTTGGAGTGGATCATCAGCTCATCGGTCAACATGGGAAGTAAATG...

CDS

Download CDS FASTA

1542 bp · TkA03G487810|TK1151|CDS

ATGGGAAGTAAATGGAAACCCATATCAATTTTCACGTTCTTCGCAATCCTTTTGTGTACTCCGATTTCTTCCACATCAAACGACGGGCTTATCAGAATTGGATTGAAAAAAGTGAAAATTGATGAAACCAATCGGATTGCTTCAGGACTCGGTTTCAAAGAAAGCGAATCTTTAAAGGAATCGATTAGAAAATACACGCAAAGTGTTAATAATGTCGGTGGTTCCCAAGAGCCCGATATTGTGTCACTAAAGAACTACAT...

Protein

Download Protein FASTA

513 aa · TkA03G487810|TK1151|PROTEIN

MGSKWKPISIFTFFAILLCTPISSTSNDGLIRIGLKKVKIDETNRIASGLGFKESESLKESIRKYTQSVNNVGGSQEPDIVSLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCLFSVSCFVHAKYRSSQSQTYKANGKSAAIQYGTGSISGYFSEDNVQIGDLVVEDQMFIEATREPGVTFLAGKFDGILGLGFKEISVGDAVPVWYNMIDQHLIKDRVFSFWMNRNSEEGEGGEIVFGGVDPKHYKGAHT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G487810`
TK1151 ID	TkA03G487810
OH-1004 ID	LXL04_009983
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 93.784 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G487810

Location Chr03:122071266-122077527 (-)

Description Similar to APA1: Aspartic proteinase A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11910`	Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles (By similarity).	No verified direct reference in this release
`At1g62290`	Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0567100`	Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009983 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0071484 cellular response to light intensity Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ag:CAA39602

ath:AT1G11910

ath:AT1G62290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.536

Rank 1 · TkA03G487810 · TK1151

Extracellular0.237

Rank 2 · TkA03G487810 · TK1151

Cytoplasm0.154

Rank 3 · TkA03G487810 · TK1151

Endoplasmic reticulum0.116

Rank 4 · TkA03G487810 · TK1151

Cell membrane0.113

Rank 5 · TkA03G487810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00026Asp90-512 aa

PF14543TAXi_N91-249 aa

PF05184SapB_1322-327 aa

PF03489SapB_2324-358 aa

PF26848Phage_T5_Nicking_endo373-400 aa

PF00610DEP383-420 aa

PF05184SapB_1385-422 aa

PF14541TAXi_C395-510 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G487810	`PF00026`	Asp	90	512	2.1e-116	389.5
TkA03G487810	`PF14543`	TAXi_N	91	249	1.3e-13	52.3
TkA03G487810	`PF05184`	SapB_1	322	327	0.003	18.3
TkA03G487810	`PF03489`	SapB_2	324	358	3.6e-05	24.5
TkA03G487810	`PF26848`	Phage_T5_Nicking_endo	373	400	0.33	11.5
TkA03G487810	`PF00610`	DEP	383	420	0.14	12.8
TkA03G487810	`PF05184`	SapB_1	385	422	0.003	18.3
TkA03G487810	`PF14541`	TAXi_C	395	510	0.00094	19.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65390`	Arabidopsis thaliana	sp\|O65390\|APA1_ARATH Aspartic proteinase A1	59.700%	Swiss-Prot	High
`Q8VYL3`	Arabidopsis thaliana	sp\|Q8VYL3\|APA2_ARATH Aspartic proteinase A2	59.500%	Swiss-Prot	High
`Q42456`	Oryza sativa subsp. japonica	sp\|Q42456\|ASPR1_ORYSJ Aspartic proteinase oryzasin-1	61.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card