LXL04_009983 | RubberDandelionOmics

Gene overview

LXL04_009983

Reference: OH-1004 Chr: Chr02 Coordinates: 137230566-137233995 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1644 bp · LXL04_009983|LXL04_009983|OH1004|cDNA

ATGCCATACCGTCATACCGTGTTTAGATTATATCTTCTTAAAGCATTAATTTCAAATTCTACAGCTTTTGCAAGTGGGAATCTCTCTGCAAAGGTGGTCAACATGGGAAGTAAATGGAAACCCATATCAATTCTCATGTTCTGTTCAATCCTTTTGTGTACTCCGATCTCTTCCACATCAAACGACGGGCTTATCAGAATCGGATTGAAAAAAGTGAAAATTGATGAAACCAATCGGATTGCTTCAGGACTCGGTTTCAA...

CDS

Download CDS FASTA

1644 bp · LXL04_009983|LXL04_009983|OH1004|CDS

ATGCCATACCGTCATACCGTGTTTAGATTATATCTTCTTAAAGCATTAATTTCAAATTCTACAGCTTTTGCAAGTGGGAATCTCTCTGCAAAGGTGGTCAACATGGGAAGTAAATGGAAACCCATATCAATTCTCATGTTCTGTTCAATCCTTTTGTGTACTCCGATCTCTTCCACATCAAACGACGGGCTTATCAGAATCGGATTGAAAAAAGTGAAAATTGATGAAACCAATCGGATTGCTTCAGGACTCGGTTTCAA...

Protein

Download Protein FASTA

547 aa · LXL04_009983|LXL04_009983|OH1004|PROTEIN

MPYRHTVFRLYLLKALISNSTAFASGNLSAKVVNMGSKWKPISILMFCSILLCTPISSTSNDGLIRIGLKKVKIDETNRIASGLGFKESESLKESIRKYTQSVNNVGGSQEPDIVSLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCLFSVSCFVHAKYRSSQSQTYKANGKSAAIQYGTGSISGYFSEDNVQIGDLVVEDQMFIEATREPGVTFLAGKFDGILGLGFKEISVGDAVPVWYNMIDQHLIKD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009983`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009983

Location Chr02:137230566-137233995 (-)

Description Similar to APA1: Aspartic proteinase A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11910`	Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles (By similarity).	No verified direct reference in this release
`At1g62290`	Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0567100`	Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009983 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0071484 cellular response to light intensity Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ag:CAA39602

ath:AT1G11910

ath:AT1G62290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.555

Rank 1 · LXL04_009983 · OH-1004

Extracellular0.191

Rank 2 · LXL04_009983 · OH-1004

Cytoplasm0.158

Rank 3 · LXL04_009983 · OH-1004

Cell membrane0.124

Rank 4 · LXL04_009983 · OH-1004

Endoplasmic reticulum0.123

Rank 5 · LXL04_009983 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00026.29Asp124-546 aa

PF14543.12TAXi_N125-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009983	`PF00026.29`	Asp	124	546	2e-116	389.5
LXL04_009983	`PF14543.12`	TAXi_N	125	283	1.4e-13	52.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65390`	Arabidopsis thaliana	Aspartic proteinase A1	59.883%	Swiss-Prot	strong database homology
`Q8VYL3`	Arabidopsis thaliana	Aspartic proteinase A2	59.496%	Swiss-Prot	strong database homology
`Q42456`	Oryza sativa subsp. japonica	Aspartic proteinase oryzasin-1	62.753%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card