TkA03G487310 | RubberDandelionOmics

Gene overview

TkA03G487310

Reference: TK1151 Chr: Chr03 Coordinates: 121961559-121963340 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · TkA03G487310|TK1151|cDNA

ATTCACAATGTGGTGTTTAAACCAATCTCGCATTTGGCAAAAAAGACTATTCCAGGGGTTCGGTGTAACATCTTGAAAGTGACGAATGATCTTGACTCGCTAGGCATTGCTGTTTCGTCCATAATGGGAGTTAAGCTAAAATCTGGTGGGTCCACACTTTTTTGGTTAGAAGATTGGCTGGGTGATGGAGCGCTTGTGGATAGATTCCCGCTTTTGTACGGGCTGGAAAAAAAGAAGTCTTGTCTAGTTGAGGATAGAGT...

CDS

Download CDS FASTA

981 bp · TkA03G487310|TK1151|CDS

ATTCACAATGTGGTGTTTAAACCAATCTCGCATTTGGCAAAAAAGACTATTCCAGGGGTTCGGTGTAACATCTTGAAAGTGACGAATGATCTTGACTCGCTAGGCATTGCTGTTTCGTCCATAATGGGAGTTAAGCTAAAATCTGGTGGGTCCACACTTTTTTGGTTAGAAGATTGGCTGGGTGATGGAGCGCTTGTGGATAGATTCCCGCTTTTGTACGGGCTGGAAAAAAAGAAGTCTTGTCTAGTTGAGGATAGAGT...

Protein

Download Protein FASTA

326 aa · TkA03G487310|TK1151|PROTEIN

IHNVVFKPISHLAKKTIPGVRCNILKVTNDLDSLGIAVSSIMGVKLKSGGSTLFWLEDWLGDGALVDRFPLLYGLEKKKSCLVEDRVKQGGSEVNSGWKRVPNSPEEQQEITLLTDILEHIRLSGGNDDWISKLSGDEKFYVQQLRALINSALTSPMTNPIVWVRLVPLKVNTFIWRACIDRLPSSLALTKRGISITDQTCPMCNNEDESIDHVLISCPFAKEIIDWVFGWVKIPLQQFTSVGEFISFAGNWGTCPKKRR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G487310`
TK1151 ID	TkA03G487310
OH-1004 ID	LXL04_006182
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	45.400
Protein coverage (%)	TK1151 100.000 / OH-1004 10.523 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G487310`
Location	Chr03:121961559-121963340 (+)
Description	Similar to mcd4: GPI ethanolamine phosphate transferase 1 (Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006182` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006506 GPI anchor biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0051377 mannose-ethanolamine phosphotransferase activity Molecular Function
KEGG gene cross-reference	afm:AFUA_4G03970 aor:AO090011000320 hsa:23556 ncr:NCU07999 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.556

Rank 1 · TkA03G487310 · TK1151

Nucleus0.279

Rank 2 · TkA03G487310 · TK1151

Cell membrane0.173

Rank 3 · TkA03G487310 · TK1151

Golgi apparatus0.078

Rank 4 · TkA03G487310 · TK1151

Lysosome / Vacuole0.063

Rank 5 · TkA03G487310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966zf-RVT156-224 aa

PF13966zf-RVT270-277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G487310	`PF13966`	zf-RVT	156	224	3.2e-16	60.4
TkA03G487310	`PF13966`	zf-RVT	270	277	3.2e-16	60.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card