LXL04_006182 | RubberDandelionOmics

Gene overview

LXL04_006182

Reference: OH-1004 Chr: Chr02 Coordinates: 3316229-3339878 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

9240 bp · LXL04_006182|LXL04_006182|OH1004|cDNA

atgcaaccgtccgatGCCTTGCAAACTTCGAaggatgctgatgcgaatccaaaagctgtccgaagtcttgcgaacttcgaaagctggacagCTGCGCGACTTAACtctatagtgtcgctggtcggaccaggctcGGATCTCGGCGTCGTGCTCGGCCatgctcggaccagtgccgagaggcatttggtcgggcacttggcgtgcgaccaaaacgacccggatcttcaaatcgcgattccggcttcgtttctccaccaaat...

CDS

Download CDS FASTA

9240 bp · LXL04_006182|LXL04_006182|OH1004|CDS

ATGCAACCGTCCGATGCCTTGCAAACTTCGAAGGATGCTGATGCGAATCCAAAAGCTGTCCGAAGTCTTGCGAACTTCGAAAGCTGGACAGCTGCGCGACTTAACTCTATAGTGTCGCTGGTCGGACCAGGCTCGGATCTCGGCGTCGTGCTCGGCCATGCTCGGACCAGTGCCGAGAGGCATTTGGTCGGGCACTTGGCGTGCGACCAAAACGACCCGGATCTTCAAATCGCGATTCCGGCTTCGTTTCTCCACCAAAT...

Protein

Download Protein FASTA

3079 aa · LXL04_006182|LXL04_006182|OH1004|PROTEIN

MQPSDALQTSKDADANPKAVRSLANFESWTAARLNSIVSLVGPGSDLGVVLGHARTSAERHLVGHLACDQNDPDLQIAIPASFLHQIRRGLFLSARNQEGYKSPKEISRKMERKVTDLEMAAIGGGCDGVGPDSGVVRPCSWSGFGRGSEGVRMVCLIPTEVAEFGVSATGGGCRRRDEHNPIGRFRFGVSICFSGDIDGGGTVVAGGDCGARRWFQVEGSTSGDAATTTSQLRRSDRGGFQNGSAQVVGGGVWARIVGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006182`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_006182`
Location	Chr02:3316229-3339878 (+)
Description	Similar to mcd4: GPI ethanolamine phosphate transferase 1 (Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006182` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006506 GPI anchor biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0051377 mannose-ethanolamine phosphotransferase activity Molecular Function
KEGG gene cross-reference	afm:AFUA_4G03970 aor:AO090011000320 hsa:23556 ncr:NCU07999 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.247

Rank 1 · LXL04_006182 · OH-1004

Cytoplasm0.242

Rank 2 · LXL04_006182 · OH-1004

Endoplasmic reticulum0.190

Rank 3 · LXL04_006182 · OH-1004

Nucleus0.176

Rank 4 · LXL04_006182 · OH-1004

Golgi apparatus0.124

Rank 5 · LXL04_006182 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966.12zf-RVT342-406 aa

PF01663.28Phosphodiest531-747 aa

PF04987.20PigN934-1413 aa

PF03372.30Exo_endo_phos1961-2128 aa

PF00078.33RVT_12425-2622 aa

PF13966.12zf-RVT2911-2975 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006182	`PF13966.12`	zf-RVT	342	406	5.5e-19	69.3
LXL04_006182	`PF01663.28`	Phosphodiest	531	747	1.2e-07	32.4
LXL04_006182	`PF04987.20`	PigN	934	1413	9.8e-124	414.3
LXL04_006182	`PF03372.30`	Exo_endo_phos	1961	2128	5.5e-08	33.5
LXL04_006182	`PF00078.33`	RVT_1	2425	2622	2.4e-13	51.1
LXL04_006182	`PF13966.12`	zf-RVT	2911	2975	5.5e-19	69.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card