TkA03G473130 | RubberDandelionOmics

Gene overview

TkA03G473130

Reference: TK1151 Chr: Chr03 Coordinates: 118266336-118270371 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1745 bp · TkA03G473130|TK1151|cDNA

GCAGAATACATCCACACCAATTCTTTTCCAACACCTCCCAAAGTCTTTTTACTATAAATACCTTCCTACACACACACACATTTAACACATCAACCTCCAGCTTTCGCACACATCTGTAGATCACCACATAAAATCGTGCCAAACCGTTACCACGATCTGCGATTTCGATAAGTTCTTTGTGAATCGATTCATCGATCGGATCGAGCGGAAAGTAGTTTGATCTGATTGATTAACGATAAAATGGGGAGTTTAAAGGCAGT...

CDS

Download CDS FASTA

1257 bp · TkA03G473130|TK1151|CDS

ATGGGGAGTTTAAAGGCAGTATTGAAGCATCCCGACGATTTTTTCCCGCTGTTGAAGTTGAAGATAGCTGCGAAAAAGGCTGAGAAACAGATCCCGGCGGAGCCACACTGGGGATTCTGTTACTCTATGCTTCATAAGGTTTCTAGAAGCTTCGCGCTTGTTATTCAACAGCTCAATCCGGAGCTTCGTGATGCTGTTTGCATTTTCTATCTGGTTCTTCGTGCCCTTGACACCGTTGAGGACGATACAAGTATAGAGGC...

Protein

Download Protein FASTA

418 aa · TkA03G473130|TK1151|PROTEIN

MGSLKAVLKHPDDFFPLLKLKIAAKKAEKQIPAEPHWGFCYSMLHKVSRSFALVIQQLNPELRDAVCIFYLVLRALDTVEDDTSIEADIKVPILIAFHEHIYDRDWHFACGTKEYKVLMDQFHHVSAAFLELKKSYQEAIKDITMRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGLGLSKLFHASGTEKLFPDSISNSMGLFLQKINIIRDYLEDINEIPKSRMFWPREIWSKYVNKLEELKYEENSDKAVQCLNDMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G473130`
TK1151 ID	TkA03G473130
OH-1004 ID	LXL04_019755
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	72.600
Protein coverage (%)	TK1151 98.325 / OH-1004 97.630 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G473130`
Location	Chr03:118266336-118270371 (+)
Description	Similar to SS2: Squalene synthase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019755` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002238 response to molecule of fungal origin Biological Process GO:0008299 isoprenoid biosynthetic process Biological Process GO:0009723 response to ethylene Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0016104 triterpenoid biosynthetic process Biological Process GO:0016135 saponin biosynthetic process Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0045338 farnesyl diphosphate metabolic process Biological Process GO:0071731 response to nitric oxide Biological Process GO:1902438 response to vanadate(3-) Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.792

Rank 1 · TkA03G473130 · TK1151

Cytoplasm0.115

Rank 2 · TkA03G473130 · TK1151

Golgi apparatus0.085

Rank 3 · TkA03G473130 · TK1151

Nucleus0.078

Rank 4 · TkA03G473130 · TK1151

Cell membrane0.072

Rank 5 · TkA03G473130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09940DUF217234-42 aa

PF00494SQS_PSY44-315 aa

PF09940DUF217289-125 aa

PF16688CNV-Replicase_N112-185 aa

PF20715DUF6827116-157 aa

PF20715DUF6827162-183 aa

PF14663RasGEF_N_2213-243 aa

PF20715DUF6827231-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G473130	`PF09940`	DUF2172	34	42	0.13	13.3
TkA03G473130	`PF00494`	SQS_PSY	44	315	6.1e-53	180.9
TkA03G473130	`PF09940`	DUF2172	89	125	0.13	13.3
TkA03G473130	`PF16688`	CNV-Replicase_N	112	185	0.16	13.1
TkA03G473130	`PF20715`	DUF6827	116	157	0.68	10.4
TkA03G473130	`PF20715`	DUF6827	162	183	0.68	10.4
TkA03G473130	`PF14663`	RasGEF_N_2	213	243	0.13	13.4
TkA03G473130	`PF20715`	DUF6827	231	270	0.68	10.4
TkA03G473130	`PF14663`	RasGEF_N_2	253	290	0.13	13.4
TkA03G473130	`PF14663`	RasGEF_N_2	348	372	0.13	13.4
TkA03G473130	`PF20715`	DUF6827	354	401	0.68	10.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card