Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1269 bp · LXL04_019755|LXL04_019755|OH1004|cDNA
ATGAGTCACGATACAATGGGGACTTTAAAGGCGGTGCTGCAGCATCCGGATGATTTTTATCCATTGTTGAAGCTGATGATGGCGGTCAAACAGGCGGAGAAACAGATCCCGGCGTTGCCACATTGGGGATTTTGTTATTCAATGCTTCATAAGGTTTCTAGAAGCTTCGGACTCGTTATTCAACAGCTTGGCTCGGAGCTTCGTGACGCTGTATGCGTTTTTTATTTGCTTCTTCGAGCCCTTGACACTGTTGAGGATGA...
1269 bp · LXL04_019755|LXL04_019755|OH1004|CDS
ATGAGTCACGATACAATGGGGACTTTAAAGGCGGTGCTGCAGCATCCGGATGATTTTTATCCATTGTTGAAGCTGATGATGGCGGTCAAACAGGCGGAGAAACAGATCCCGGCGTTGCCACATTGGGGATTTTGTTATTCAATGCTTCATAAGGTTTCTAGAAGCTTCGGACTCGTTATTCAACAGCTTGGCTCGGAGCTTCGTGACGCTGTATGCGTTTTTTATTTGCTTCTTCGAGCCCTTGACACTGTTGAGGATGA...
Protein
Download Protein FASTA422 aa · LXL04_019755|LXL04_019755|OH1004|PROTEIN
MSHDTMGTLKAVLQHPDDFYPLLKLMMAVKQAEKQIPALPHWGFCYSMLHKVSRSFGLVIQQLGSELRDAVCVFYLLLRALDTVEDDTTIDTMTKIPILMEFHRHIYDPYWHFSCGTKEYKILMDRFHHVSTAFLELNASFQEAIEDITMKMGAGMAKFICKEEVVSIADYDEYCHYVAGHVGLGLSKLFHASGKEVLFPESTSNAMGLFLQKTNIVRDFLVDINEVPKSRVYWPRQVWSRYASKPEDLKHKDNSKKAVQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_019755 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_019755 |
|---|---|
| Location | Chr04:39314212-39319518 (-) |
| Description | Similar to SS2: Squalene synthase 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002238 response to molecule of fungal origin Biological Process GO:0008299 isoprenoid biosynthetic process Biological Process GO:0009723 response to ethylene Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0016104 triterpenoid biosynthetic process Biological Process GO:0016135 saponin biosynthetic process Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0045338 farnesyl diphosphate metabolic process Biological Process GO:0071731 response to nitric oxide Biological Process GO:1902438 response to vanadate(3-) Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component |
| KEGG gene cross-reference | No functional description available |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00494.25SQS_PSY49-321 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_019755 | PF00494.25 | SQS_PSY | 49 | 321 | 5.6e-52 | 177.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.