TkA03G471920 | RubberDandelionOmics

Gene overview

TkA03G471920

Reference: TK1151 Chr: Chr03 Coordinates: 117947181-117950682 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1777 bp · TkA03G471920|TK1151|cDNA

AAAATCACCTGTGTGTTGTATTTTCTTACTATCAAAAATCACATAATTACGTTCGGAACAAAAAAGAGCCTATTTTTACGATTAACTGAATTCGTTATTCTTTTTCATGGAAGATCTGTTTAGTGATGATTTCTCAAGTGTGATTTATTATATAATCGATGGAAATTCAGCCAGTAAGCTCTAATTTCTCCACCTGTTCAAGAATCATCAGTTCTTGTTGCATTTGGTGCTGATTTTTGAGATCTTTGGTTCGATAATCG...

CDS

Download CDS FASTA

1116 bp · TkA03G471920|TK1151|CDS

ATGGAAGCTTTGTGTGATCTCTGTAGTGTAGCGAGGGCAGTGGTTTATTGCAAATCGGATGCTGCAAAATTATGCGTCCAGTGCGACAACCGTGTGCACTCTGCTAATTCATTATCAAGCAGACACACTCGTTCCCTCCTCTGTGATAACTGTAACCTGCACCCGGCTGTCACCCACCGTCTGTTCGATAAAATGTTTCTGTGTCACGTTTGTGATCTGAATGAGAACCGATGCTCATCAGGGCAAGGACACAGCATTGA...

Protein

Download Protein FASTA

371 aa · TkA03G471920|TK1151|PROTEIN

MEALCDLCSVARAVVYCKSDAAKLCVQCDNRVHSANSLSSRHTRSLLCDNCNLHPAVTHRLFDKMFLCHVCDLNENRCSSGQGHSIEELNAYSGCPSDEEFLNILSTIRGGGPTNDPQFHPISSLNLNDNIINDQNNEEQMGLVASHLNDLTSAVKFDPWIVDPSSIIPPPLTYLPSCDHKDPNSFFPNGPNLTKDGSNLNNLGLDEGEDLCENVDLGDVALGFEQDCTTFPVPQMAATANVMQVVSGGGGGGMVLNPGC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G471920`
TK1151 ID	TkA03G471920
OH-1004 ID	LXL04_009789
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G471920

Location Chr03:117947181-117950682 (+)

Description Similar to COL11: Putative zinc finger protein CONSTANS-LIKE 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15250`	Putative zinc finger protein CONSTANS-LIKE 11.	No verified direct reference in this release
`At3g21880`	Zinc finger protein CONSTANS-LIKE 12.	No verified direct reference in this release
`At3g07650`	Zinc finger protein CONSTANS-LIKE 9.	No verified direct reference in this release
`At5g48250`	Zinc finger protein CONSTANS-LIKE 10.	No verified direct reference in this release
`At2g47890`	Zinc finger protein CONSTANS-LIKE 13.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009789 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT3G07650

ath:AT3G21880

ath:AT4G15250

ath:AT5G15850

ath:AT5G48250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.841

Rank 1 · TkA03G471920 · TK1151

Cytoplasm0.228

Rank 2 · TkA03G471920 · TK1151

Cell membrane0.046

Rank 3 · TkA03G471920 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA03G471920 · TK1151

Lysosome / Vacuole0.018

Rank 5 · TkA03G471920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16366CEBP_ZZ2-42 aa

PF00643zf-B_box3-44 aa

PF22586ANCHR-like_BBOX4-42 aa

PF23067MG2805-37 aa

PF03660PHF521-56 aa

PF00643zf-B_box46-75 aa

PF16366CEBP_ZZ47-57 aa

PF22586ANCHR-like_BBOX47-84 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G471920	`PF16366`	CEBP_ZZ	2	42	0.026	15.5
TkA03G471920	`PF00643`	zf-B_box	3	44	5.4e-05	24.0
TkA03G471920	`PF22586`	ANCHR-like_BBOX	4	42	0.038	14.8
TkA03G471920	`PF23067`	MG280	5	37	0.25	11.5
TkA03G471920	`PF03660`	PHF5	21	56	6.3	7.8
TkA03G471920	`PF00643`	zf-B_box	46	75	5.4e-05	24.0
TkA03G471920	`PF16366`	CEBP_ZZ	47	57	0.026	15.5
TkA03G471920	`PF22586`	ANCHR-like_BBOX	47	84	0.038	14.8
TkA03G471920	`PF16366`	CEBP_ZZ	67	75	0.026	15.5
TkA03G471920	`PF02045`	CBFB_NFYA	314	360	1.0	10.4
TkA03G471920	`PF06203`	CCT	315	357	1.6e-17	64.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23379`	Arabidopsis thaliana	sp\|O23379\|COL11_ARATH Putative zinc finger protein CONSTANS-LIKE 11	45.100%	Swiss-Prot	Medium
`Q9LJ44`	Arabidopsis thaliana	sp\|Q9LJ44\|COL12_ARATH Zinc finger protein CONSTANS-LIKE 12	41.900%	Swiss-Prot	Medium
`Q9SSE5`	Arabidopsis thaliana	sp\|Q9SSE5\|COL9_ARATH Zinc finger protein CONSTANS-LIKE 9	39.300%	Swiss-Prot	Medium
`Q9LUA9`	Arabidopsis thaliana	sp\|Q9LUA9\|COL10_ARATH Zinc finger protein CONSTANS-LIKE 10	35.800%	Swiss-Prot	Medium
`O82256`	Arabidopsis thaliana	sp\|O82256\|COL13_ARATH Zinc finger protein CONSTANS-LIKE 13	33.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card