LXL04_009789 | RubberDandelionOmics

Gene overview

LXL04_009789

Reference: OH-1004 Chr: Chr02 Coordinates: 133436642-133439076 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1119 bp · LXL04_009789|LXL04_009789|OH1004|cDNA

ATGGAAGCTTTGTGTGATCTCTGTAGTGTAGCGAGGGCAGTGGTTTATTGCAAATCGGATGCTGCAAAATTATGCGTCCAGTGCGACAACCGTGTGCACTCTGCTAATTCATTATCAAGCAGACACACTCGTTCCCTCCTCTGTGATAACTGTAACCTGCACCCGGCTGTCACCCACCGTCTGTTCGATAAAATGTTTCTGTGTCACGTTTGTGATCTGAATGAGAACCGATGCTCATCAGGGCAAGGACACAGCATTGA...

CDS

Download CDS FASTA

1119 bp · LXL04_009789|LXL04_009789|OH1004|CDS

ATGGAAGCTTTGTGTGATCTCTGTAGTGTAGCGAGGGCAGTGGTTTATTGCAAATCGGATGCTGCAAAATTATGCGTCCAGTGCGACAACCGTGTGCACTCTGCTAATTCATTATCAAGCAGACACACTCGTTCCCTCCTCTGTGATAACTGTAACCTGCACCCGGCTGTCACCCACCGTCTGTTCGATAAAATGTTTCTGTGTCACGTTTGTGATCTGAATGAGAACCGATGCTCATCAGGGCAAGGACACAGCATTGA...

Protein

Download Protein FASTA

372 aa · LXL04_009789|LXL04_009789|OH1004|PROTEIN

MEALCDLCSVARAVVYCKSDAAKLCVQCDNRVHSANSLSSRHTRSLLCDNCNLHPAVTHRLFDKMFLCHVCDLNENRCSSGQGHSIEELNAYSGCPSDEEFLNILSTIRGGGPTNDPQFHPISSLNLNDNIINDQNNEEQMGLVASHLNDLTSAVKFDPWIVDPSSIIPPPLTYLPSCDHKDPNPFFPNGPNLTKDGSNLNNLGLDEGEDLCENVDLGDVALGFEQDCTTFPVPQMAATANVMQAMSGGGGGGGMLMNPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009789`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009789

Location Chr02:133436642-133439076 (+)

Description Similar to COL11: Putative zinc finger protein CONSTANS-LIKE 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15250`	Putative zinc finger protein CONSTANS-LIKE 11.	No verified direct reference in this release
`At3g21880`	Zinc finger protein CONSTANS-LIKE 12.	No verified direct reference in this release
`At3g07650`	Zinc finger protein CONSTANS-LIKE 9.	No verified direct reference in this release
`At5g48250`	Zinc finger protein CONSTANS-LIKE 10.	No verified direct reference in this release
`At5g15850`	Putative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009789 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT3G07650

ath:AT3G21880

ath:AT4G15250

ath:AT5G15850

ath:AT5G48250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.845

Rank 1 · LXL04_009789 · OH-1004

Cytoplasm0.224

Rank 2 · LXL04_009789 · OH-1004

Cell membrane0.046

Rank 3 · LXL04_009789 · OH-1004

Endoplasmic reticulum0.037

Rank 4 · LXL04_009789 · OH-1004

Lysosome / Vacuole0.017

Rank 5 · LXL04_009789 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06203.20CCT316-358 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009789	`PF06203.20`	CCT	316	358	1.6e-17	64.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23379`	Arabidopsis thaliana	Putative zinc finger protein CONSTANS-LIKE 11	39.842%	Swiss-Prot	moderate database homology
`Q9LJ44`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 12	39.796%	Swiss-Prot	moderate database homology
`Q9SSE5`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 9	34.375%	Swiss-Prot	moderate database homology
`Q9LUA9`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 10	32.432%	Swiss-Prot	moderate database homology
`O50055`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 1	26.087%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card