TkA03G468950 | RubberDandelionOmics

Gene overview

TkA03G468950

Reference: TK1151 Chr: Chr03 Coordinates: 117198544-117200805 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1447 bp · TkA03G468950|TK1151|cDNA

GTCGTTTCTTTCTGCGTGTGTGCTCTCTCCGCCATTCCTTTACCAAAAGTCTGCATCTATAAATACAACCCTCTTTGTTCCAACTCTGATATAACAAAATTTTCAAATCGATCTCAAAACCAACACCTAGAAGCTCGAAAATGGCGGAGAAAGTAGGAGAAGAACAATTGGAAGAAGAGAAAATCCCTCTTCTCACTCCCTACAAAATGGGTAGATTTGAGCTTTCTCACAGAGTTGTATTGGCACCATTAACAAGGCAA...

CDS

Download CDS FASTA

1137 bp · TkA03G468950|TK1151|CDS

ATGGCGGAGAAAGTAGGAGAAGAACAATTGGAAGAAGAGAAAATCCCTCTTCTCACTCCCTACAAAATGGGTAGATTTGAGCTTTCTCACAGAGTTGTATTGGCACCATTAACAAGGCAACGATCCTTTGGGAATGTCCCTCAGCCACACGCAATTTTATATTATTCGCAAAGAACAACCAAAGGAGGCCTTCTTATTACAGAAGCCACCGGAGTTTCCGACACCGCCCAAGGGTATCCAGACACACCGGGTATCTGGAC...

Protein

Download Protein FASTA

378 aa · TkA03G468950|TK1151|PROTEIN

MAEKVGEEQLEEEKIPLLTPYKMGRFELSHRVVLAPLTRQRSFGNVPQPHAILYYSQRTTKGGLLITEATGVSDTAQGYPDTPGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTGFQPNGQAPISSSDKELFPQIRSNGIDVAKFTPPRKLTTEEIPLVVNDFRVAARNAIEAGFDGVEIHGAHGYLIEQFLKDQVNDRTDKYGGSLQNRCRFAFEIVDAVVNEIGSDRVGIRLSPYAEYMEAADSNPEALGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G468950`
TK1151 ID	TkA03G468950
OH-1004 ID	LXL04_009755
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G468950

Location Chr03:117198544-117200805 (+)

Description Similar to OPR11: Putative 12-oxophytodienoate reductase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76680`	Specifically cleaves olefinic bonds in alpha,beta-unsaturated carbonyls and may be involved in detoxification or modification of these reactive compounds.	12-Oxophytodienoate reductase 3 (OPR3) is the isoenzyme involved in jasmonate biosynthesis.2000 · DOI: 10.1007/s004250050706 The role of oxophytodienoate reductases in the detoxification of the explosive 2,4,6-trinitrotoluene by Arabidopsis.2009 · DOI: 10.1104/pp.109.141598
`At1g76690`	Specifically cleaves olefinic bonds in alpha,beta-unsaturated carbonyls and may be involved in detoxification or modification of these reactive compounds (Probable).	12-Oxophytodienoate reductase 3 (OPR3) is the isoenzyme involved in jasmonate biosynthesis.2000 · DOI: 10.1007/s004250050706 The role of oxophytodienoate reductases in the detoxification of the explosive 2,4,6-trinitrotoluene by Arabidopsis.2009 · DOI: 10.1104/pp.109.141598 An OPR3-independent pathway uses 4,5-didehydrojasmonate for jasmonate synthesis.2018 · DOI: 10.1038/nchembio.2540

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B9FSC8`	Putative oxophytodienoate reductase that may be involved in the biosynthesis or metabolism of oxylipin signaling molecules.	No verified direct reference in this release
`Os06g0215900`	Putative oxophytodienoate reductase that may be involved in the biosynthesis or metabolism of oxylipin signaling molecules.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009755 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0031407 oxylipin metabolic process Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G76680

ath:AT1G76690

dosa:Os06g0216300

sly:544239

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.770

Rank 1 · TkA03G468950 · TK1151

Nucleus0.289

Rank 2 · TkA03G468950 · TK1151

Peroxisome0.103

Rank 3 · TkA03G468950 · TK1151

Mitochondrion0.083

Rank 4 · TkA03G468950 · TK1151

Plastid0.041

Rank 5 · TkA03G468950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00724Oxidored_FMN17-350 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G468950	`PF00724`	Oxidored_FMN	17	350	1.2e-87	295.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LAH7`	Arabidopsis thaliana	sp\|Q8LAH7\|OPR1_ARATH 12-oxophytodienoate reductase 1	80.000%	Swiss-Prot	High
`Q8GYB8`	Arabidopsis thaliana	sp\|Q8GYB8\|OPR2_ARATH 12-oxophytodienoate reductase 2	78.600%	Swiss-Prot	High
`B9FSC8`	Oryza sativa subsp. japonica	sp\|B9FSC8\|OPR11_ORYSJ Putative 12-oxophytodienoate reductase 11	80.700%	Swiss-Prot	High
`Q69TH8`	Oryza sativa subsp. japonica	sp\|Q69TH8\|OPR4_ORYSJ Putative 12-oxophytodienoate reductase 4	68.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card