LXL04_009755 | RubberDandelionOmics

Gene overview

LXL04_009755

Reference: OH-1004 Chr: Chr02 Coordinates: 132748886-132751548 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1282 bp · LXL04_009755|LXL04_009755|OH1004|cDNA

GAGGTGGCTGGCTGCTTTCTTTCTCGAGTGTCAGTCTATCGTCACTGCCTTCCCTTCAACAAATTGGGCATCTATAAAACAAACCCACTTCATTCGGCCTACCAATATAACGATCTTCTCAATCAATCTTTAAATCACTTGAAAAATGGCGGAGAAAGATTTCGAAAAACAAGTGCAAGAAGGGAAGAAAATCCCTCTTCTCACTCCCTACAAAATGGGTAAATTTGAGCTTTCTCACAGAGTTGTATTGGCACCATTAA...

CDS

Download CDS FASTA

1137 bp · LXL04_009755|LXL04_009755|OH1004|CDS

ATGGCGGAGAAAGATTTCGAAAAACAAGTGCAAGAAGGGAAGAAAATCCCTCTTCTCACTCCCTACAAAATGGGTAAATTTGAGCTTTCTCACAGAGTTGTATTGGCACCATTAACAAGGCTAAGATCCTTCGGGAATGTCCCTCAGCCACACGCAATTTTATATTATTCACAAAGAACAACCAAAGGAGGCCTTCTTATCGCGGAAGCCACTGTAATTTCCGACACTGCCCGAGGGTATCCAGACACACCGGGTATCTG...

Protein

Download Protein FASTA

378 aa · LXL04_009755|LXL04_009755|OH1004|PROTEIN

MAEKDFEKQVQEGKKIPLLTPYKMGKFELSHRVVLAPLTRLRSFGNVPQPHAILYYSQRTTKGGLLIAEATVISDTARGYPDTPGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNTSFQPNGQAPISSTDKEIYPQIRSNGIDVAQFSPPRRLTTEEIPLVVNDFRVAARNAIEAGFDGVEIHGAHGYLIEQFMKHKVNDRTDQYGGSLQNRCRFALEVVEAVANEVGPDRVGIRLSPFTAFMEADDSNPEALG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009755`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009755

Location Chr02:132748886-132751548 (+)

Description Similar to OPR11: Putative 12-oxophytodienoate reductase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76690`	Specifically cleaves olefinic bonds in alpha,beta-unsaturated carbonyls and may be involved in detoxification or modification of these reactive compounds (Probable).	12-Oxophytodienoate reductase 3 (OPR3) is the isoenzyme involved in jasmonate biosynthesis.2000 · DOI: 10.1007/s004250050706 The role of oxophytodienoate reductases in the detoxification of the explosive 2,4,6-trinitrotoluene by Arabidopsis.2009 · DOI: 10.1104/pp.109.141598 An OPR3-independent pathway uses 4,5-didehydrojasmonate for jasmonate synthesis.2018 · DOI: 10.1038/nchembio.2540
`At1g76680`	Specifically cleaves olefinic bonds in alpha,beta-unsaturated carbonyls and may be involved in detoxification or modification of these reactive compounds.	12-Oxophytodienoate reductase 3 (OPR3) is the isoenzyme involved in jasmonate biosynthesis.2000 · DOI: 10.1007/s004250050706 The role of oxophytodienoate reductases in the detoxification of the explosive 2,4,6-trinitrotoluene by Arabidopsis.2009 · DOI: 10.1104/pp.109.141598

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B9FSC8`	Putative oxophytodienoate reductase that may be involved in the biosynthesis or metabolism of oxylipin signaling molecules.	No verified direct reference in this release
`Os06g0216300`	Probably involved in the biosynthesis or metabolism of oxylipin signaling molecules.	Cloning and characterization of a jasmonic acid-responsive gene encoding 12-oxophytodienoic acid reductase in suspension-cultured rice cells.2003 · DOI: 10.1007/s00425-002-0909-z Identification of the OsOPR7 gene encoding 12-oxophytodienoate reductase involved in the biosynthesis of jasmonic acid in rice.2008 · DOI: 10.1007/s00425-007-0635-7

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009755 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0031407 oxylipin metabolic process Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G76680

ath:AT1G76690

dosa:Os06g0216300

sly:544239

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.763

Rank 1 · LXL04_009755 · OH-1004

Nucleus0.291

Rank 2 · LXL04_009755 · OH-1004

Peroxisome0.111

Rank 3 · LXL04_009755 · OH-1004

Mitochondrion0.085

Rank 4 · LXL04_009755 · OH-1004

Plastid0.037

Rank 5 · LXL04_009755 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00724.27Oxidored_FMN18-349 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009755	`PF00724.27`	Oxidored_FMN	18	349	6.4e-86	289.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYB8`	Arabidopsis thaliana	12-oxophytodienoate reductase 2	77.961%	Swiss-Prot	strong database homology
`Q8LAH7`	Arabidopsis thaliana	12-oxophytodienoate reductase 1	77.135%	Swiss-Prot	strong database homology
`B9FSC8`	Oryza sativa subsp. japonica	Putative 12-oxophytodienoate reductase 11	79.006%	Swiss-Prot	strong database homology
`Q84QK0`	Oryza sativa subsp. japonica	12-oxophytodienoate reductase 1	71.745%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card