TkA03G455440 | RubberDandelionOmics

Gene overview

TkA03G455440

Reference: TK1151 Chr: Chr03 Coordinates: 113683208-113688225 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1812 bp · TkA03G455440|TK1151|cDNA

ATGGATGCAAGCAAGTATGTGAGATACACACCAGAGCAAGGCACTAACTGGAAGACTCAATGTGGGATTTTGAACCCTGAACCCTTACATATGTTCCGTTTCGAATTCCCAAGGAAGGAAGCGTCTCGTCTTCAGACTGTTAACAGGAAGCTTACTGCCATGAATAAGCTGCTGATGGAAGAGAACGACCGCCTTCAAAAGCAGGTAAGCACGACCACTGATACAAGCTGTGACTCAGTGGTTATGAGTGGTCAACAGCA...

CDS

Download CDS FASTA

1812 bp · TkA03G455440|TK1151|CDS

ATGGATGCAAGCAAGTATGTGAGATACACACCAGAGCAAGGCACTAACTGGAAGACTCAATGTGGGATTTTGAACCCTGAACCCTTACATATGTTCCGTTTCGAATTCCCAAGGAAGGAAGCGTCTCGTCTTCAGACTGTTAACAGGAAGCTTACTGCCATGAATAAGCTGCTGATGGAAGAGAACGACCGCCTTCAAAAGCAGGTAAGCACGACCACTGATACAAGCTGTGACTCAGTGGTTATGAGTGGTCAACAGCA...

Protein

Download Protein FASTA

603 aa · TkA03G455440|TK1151|PROTEIN

MDASKYVRYTPEQGTNWKTQCGILNPEPLHMFRFEFPRKEASRLQTVNRKLTAMNKLLMEENDRLQKQVSTTTDTSCDSVVMSGQQQQQNPTPQHPQRDANSPAGLLAIAEETLAEFLGKATGTAVDWLLKFKDRLSWFRDCRCLDVASAIPTGNGGTIELVYMQICERSLTSSTGGRLGLPPLALARAEMLPSGYLIRPCEGGGSIIHIASSVPEVLRPLYESSKILAQKMTMAALRHIRQIAQETNGEVQYSGGRQPA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G455440`
TK1151 ID	TkA03G455440
OH-1004 ID	LXL04_004496
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	47.000
Protein coverage (%)	TK1151 100.000 / OH-1004 97.275 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G455440

Location Chr03:113683208-113688225 (+)

Description Similar to REV: Homeobox-leucine zipper protein REVOLUTA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34710`	Probable transcription factor involved in the determination of adaxial-abaxial polarity in ovule primordium.	No verified direct reference in this release
`At1g30490`	Probable transcription factor involved in the determination of adaxial-abaxial polarity in ovule primordium.	The Arabidopsis Athb-8, -9 and -14 genes are members of a small gene family coding for highly related HD-ZIP proteins.1998 · DOI: 10.1023/a:1006016319613

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XK30`	Probable transcription factor.	No verified direct reference in this release
`Os03g0640800`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2ZMN9`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009855 determination of bilateral symmetry Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0009956 radial pattern formation Biological Process

GO:0010014 meristem initiation Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010089 xylem development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT5G60690

dosa:Os03g0640800

dosa:Os10g0480200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.461

Rank 1 · TkA03G455440 · TK1151

Nucleus0.433

Rank 2 · TkA03G455440 · TK1151

Cell membrane0.122

Rank 3 · TkA03G455440 · TK1151

Endoplasmic reticulum0.082

Rank 4 · TkA03G455440 · TK1151

Mitochondrion0.067

Rank 5 · TkA03G455440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27412MlpA6-80 aa

PF02183HALZ50-71 aa

PF01852START110-130 aa

PF01852START134-165 aa

PF01852START166-241 aa

PF02183HALZ308-316 aa

PF08670MEKHLA504-602 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G455440	`PF27412`	MlpA	6	80	0.003	18.7
TkA03G455440	`PF02183`	HALZ	50	71	0.39	11.6
TkA03G455440	`PF01852`	START	110	130	7.4e-09	36.0
TkA03G455440	`PF01852`	START	134	165	7.4e-09	36.0
TkA03G455440	`PF01852`	START	166	241	7.4e-09	36.0
TkA03G455440	`PF02183`	HALZ	308	316	0.39	11.6
TkA03G455440	`PF08670`	MEKHLA	504	602	2.3e-30	106.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04291`	Arabidopsis thaliana	sp\|O04291\|ATB14_ARATH Homeobox-leucine zipper protein ATHB-14	53.900%	Swiss-Prot	High
`O04292`	Arabidopsis thaliana	sp\|O04292\|ATBH9_ARATH Homeobox-leucine zipper protein ATHB-9	52.300%	Swiss-Prot	High
`A2XK30`	Oryza sativa subsp. indica	sp\|A2XK30\|HOX32_ORYSI Homeobox-leucine zipper protein HOX32	53.100%	Swiss-Prot	High
`Q6AST1`	Oryza sativa subsp. japonica	sp\|Q6AST1\|HOX32_ORYSJ Homeobox-leucine zipper protein HOX32	53.100%	Swiss-Prot	High
`A2ZMN9`	Oryza sativa subsp. indica	sp\|A2ZMN9\|HOX33_ORYSI Homeobox-leucine zipper protein HOX33	51.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card