LXL04_004496 | RubberDandelionOmics

Gene overview

LXL04_004496

Reference: OH-1004 Chr: Chr01 Coordinates: 138446936-138451505 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2535 bp · LXL04_004496|LXL04_004496|OH1004|cDNA

ATGGCGATGGTAGTTCAACATCAACAGCATAAAGAGATGAGCAATAATACCAGCATCACCAAGCACCAGTTGGATAACGGGAAGTATGTCCGGTACACGACGGAGCAAGTTGAAGCTCTAGAAAGAGTTTACGCAGAATGCCCCAAACCCAGTTCTTTGAGGAGGCAACAATTAATCCGAGAATGCCCTATTTTGTCCAACATAGAACCTAAGCAAATCAAAGTCTGGTTTCAAAATCGCAGATGTCGAGAGAAGCAACG...

CDS

Download CDS FASTA

2535 bp · LXL04_004496|LXL04_004496|OH1004|CDS

ATGGCGATGGTAGTTCAACATCAACAGCATAAAGAGATGAGCAATAATACCAGCATCACCAAGCACCAGTTGGATAACGGGAAGTATGTCCGGTACACGACGGAGCAAGTTGAAGCTCTAGAAAGAGTTTACGCAGAATGCCCCAAACCCAGTTCTTTGAGGAGGCAACAATTAATCCGAGAATGCCCTATTTTGTCCAACATAGAACCTAAGCAAATCAAAGTCTGGTTTCAAAATCGCAGATGTCGAGAGAAGCAACG...

Protein

Download Protein FASTA

844 aa · LXL04_004496|LXL04_004496|OH1004|PROTEIN

MAMVVQHQQHKEMSNNTSITKHQLDNGKYVRYTTEQVEALERVYAECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKESSRLQTVNKKLSAMNKLLMEENDRLQKQVSQLVNENGYMRQQLHTSTDVSCESVVTTPQRSLRDANNPAGLLSIAEETLAEFLSKATGTAVDWVQMPGVKPGPDSVGIFAISQSCSGVAARACGLVSLEPTKIVEILKDRPSWFRDCRNLEVFTMFPAGNGGTIELLYTQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004496`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004496

Location Chr01:138446936-138451505 (+)

Description Similar to REV: Homeobox-leucine zipper protein REVOLUTA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60690`	Probable transcription factor involved in the regulation of interfascicular fiber (cortical cells) and secondary xylem differentiation in the inflorescence stems.	IFL1, a gene regulating interfascicular fiber differentiation in Arabidopsis, encodes a homeodomain-leucine zipper protein.1999 · DOI: 10.1105/tpc.11.11.2139 Alteration of auxin polar transport in the Arabidopsis ifl1 mutants.2001 · DOI: 10.1104/pp.126.2.549 Amphivasal vascular bundle 1, a gain-of-function mutation of the IFL1/REV gene, is associated with alterations in the polarity of leaves, stems and carpels.2004 · DOI: 10.1093/pcp/pch051

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0640800`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2XK30`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2Z8L4`	Probable transcription factor.	No verified direct reference in this release
`Os10g0480200`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004496 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009855 determination of bilateral symmetry Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0009956 radial pattern formation Biological Process

GO:0010014 meristem initiation Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010089 xylem development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT5G60690

dosa:Os03g0640800

dosa:Os10g0480200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.631

Rank 1 · LXL04_004496 · OH-1004

Cytoplasm0.323

Rank 2 · LXL04_004496 · OH-1004

Cell membrane0.092

Rank 3 · LXL04_004496 · OH-1004

Endoplasmic reticulum0.053

Rank 4 · LXL04_004496 · OH-1004

Plastid0.036

Rank 5 · LXL04_004496 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain28-86 aa

PF01852.26START163-371 aa

PF08670.18MEKHLA700-843 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004496	`PF00046.36`	Homeodomain	28	86	2.6e-15	56.7
LXL04_004496	`PF01852.26`	START	163	371	2.5e-44	151.9
LXL04_004496	`PF08670.18`	MEKHLA	700	843	1.6e-43	148.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SE43`	Arabidopsis thaliana	Homeobox-leucine zipper protein REVOLUTA	77.974%	Swiss-Prot	strong database homology
`Q6AST1`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX32	71.156%	Swiss-Prot	strong database homology
`A2XK30`	Oryza sativa subsp. indica	Homeobox-leucine zipper protein HOX32	71.156%	Swiss-Prot	strong database homology
`A2Z8L4`	Oryza sativa subsp. indica	Homeobox-leucine zipper protein HOX9	71.618%	Swiss-Prot	strong database homology
`Q9AV49`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX9	71.618%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card