TkA03G448250 | RubberDandelionOmics

Gene overview

TkA03G448250

Reference: TK1151 Chr: Chr03 Coordinates: 111832691-111834542 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1059 bp · TkA03G448250|TK1151|cDNA

AGCGGCGAAGTAACTCAATTGAGTAAGACTCATACGGCGAGCCGACATGACGACGAGCGAGTGCTAATTAGCGAGGTTTTAGTGAGAAACAAGGACGGCGAGGAGCTTGAAAGGAAGGATTTGGAGGAAGAGGCGGTTGCAGCATTGAAAACATGTCGACCTAATTCAGCTTTAACAGTACGCGAAGTTCAGGAAGATGTCCATAGGATCATTGGAAGCGTCTATTTCTCTTCTTGCATGCCTGTAGCAGTCGACACTCG...

CDS

Download CDS FASTA

1059 bp · TkA03G448250|TK1151|CDS

AGCGGCGAAGTAACTCAATTGAGTAAGACTCATACGGCGAGCCGACATGACGACGAGCGAGTGCTAATTAGCGAGGTTTTAGTGAGAAACAAGGACGGCGAGGAGCTTGAAAGGAAGGATTTGGAGGAAGAGGCGGTTGCAGCATTGAAAACATGTCGACCTAATTCAGCTTTAACAGTACGCGAAGTTCAGGAAGATGTCCATAGGATCATTGGAAGCGTCTATTTCTCTTCTTGCATGCCTGTAGCAGTCGACACTCG...

Protein

Download Protein FASTA

352 aa · TkA03G448250|TK1151|PROTEIN

SGEVTQLSKTHTASRHDDERVLISEVLVRNKDGEELERKDLEEEAVAALKTCRPNSALTVREVQEDVHRIIGSVYFSSCMPVAVDTRDGICLVFQVEPNQDFQGLVCEGANVLPTKFVEDAFRDGYGKIVNIRRLDQVISSINGWYMERGLFGLVSGMEILSGGILRLQVSEAEVNNIFVRFISRIGEPTTGKTRPETILRQLNTKKGQIYSMLQAKRDVDTLLAMGIMEDVSIVPQPAGDSGKVDLTINVVERVSGGIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G448250`
TK1151 ID	TkA03G448250
OH-1004 ID	LXL04_004426
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.300
Protein coverage (%)	TK1151 93.182 / OH-1004 50.076 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G448250

Location Chr03:111832691-111834542 (+)

Description Similar to OEP80: Outer envelope protein 80, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19620`	Plays an essential role during early stages of plastid development.	The Omp85-related chloroplast outer envelope protein OEP80 is essential for viability in Arabidopsis.2008 · DOI: 10.1104/pp.108.122754

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X208`	Outer envelope protein 80, chloroplastic.	No verified direct reference in this release
`Os02g0196300`	Outer envelope protein 80, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004426 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0030162 regulation of proteolysis Biological Process

GO:1900057 positive regulation of leaf senescence Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0015267 channel activity Molecular Function

KEGG gene cross-reference

ath:AT3G44160

ath:AT3G48620

ath:AT5G19620

dosa:Os02g0196300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.591

Rank 1 · TkA03G448250 · TK1151

Mitochondrion0.372

Rank 2 · TkA03G448250 · TK1151

Cytoplasm0.084

Rank 3 · TkA03G448250 · TK1151

Nucleus0.042

Rank 4 · TkA03G448250 · TK1151

Peroxisome0.039

Rank 5 · TkA03G448250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08479POTRA_230-43 aa

PF07244POTRA52-77 aa

PF08479POTRA_2104-172 aa

PF07244POTRA107-154 aa

PF17287POTRA_3118-143 aa

PF07244POTRA193-254 aa

PF25282POTRA1_3_Toc75198-251 aa

PF08479POTRA_2236-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G448250	`PF08479`	POTRA_2	30	43	0.0026	18.3
TkA03G448250	`PF07244`	POTRA	52	77	1.7e-10	42.2
TkA03G448250	`PF08479`	POTRA_2	104	172	0.0026	18.3
TkA03G448250	`PF07244`	POTRA	107	154	1.7e-10	42.2
TkA03G448250	`PF17287`	POTRA_3	118	143	0.25	11.5
TkA03G448250	`PF07244`	POTRA	193	254	1.7e-10	42.2
TkA03G448250	`PF25282`	POTRA1_3_Toc75	198	251	0.015	16.2
TkA03G448250	`PF08479`	POTRA_2	236	249	0.0026	18.3
TkA03G448250	`PF01103`	Omp85	287	332	4.5e-08	33.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5J8`	Arabidopsis thaliana	sp\|Q9C5J8\|OEP80_ARATH Outer envelope protein 80, chloroplastic	78.200%	Swiss-Prot	High
`A2X208`	Oryza sativa subsp. indica	sp\|A2X208\|OEP80_ORYSI Outer envelope protein 80, chloroplastic	76.200%	Swiss-Prot	High
`Q6H7M7`	Oryza sativa subsp. japonica	sp\|Q6H7M7\|OEP80_ORYSJ Outer envelope protein 80, chloroplastic	76.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card