TkA03G445510 | RubberDandelionOmics

Gene overview

TkA03G445510

Reference: TK1151 Chr: Chr03 Coordinates: 111121316-111122752 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

835 bp · TkA03G445510|TK1151|cDNA

AAAAAAAATGGTGTTATGGTATATATGTAGGAAAAAATGGATTTTATTAAAAAGAAAAGAAATGCAGTTTGCTTGATTTGTGCACGACGGCGAGTCACACAATTGGCATTCGGCAATCGGCAAGATTCTTTGTCGACTGCCATGTGGGTACACTAATCAAAAGCCGCCTTCATACACCTGCTCCCTCTGGTAGCTTGAGAAACAAGCAAGACTTAGGGTTTAAAATGGGAACTATGTGGAGCGGAGGACAAAAATCCAGA...

CDS

Download CDS FASTA

387 bp · TkA03G445510|TK1151|CDS

ATGGGAACTATGTGGAGCGGAGGACAAAAATCCAGAGAAGAAATCGATATGGCTCTTACCAAAGTCAAGGAAATCGTCTCCTCGAACCCCGTTGTCCTCTTCAGCAAAACTTACTGTGGATACTGCCAGAGGGTGAAAAAACTCTTCACGGAGCTTAATGCATCTTACAGGCTTCTGGAATTGGATGAAGAAAGCGATGGCAGTGCAATCCAATCAGCTCTCGCAGAGTTGACTGGTCAGACGACTGTACCAAATGTGTT...

Protein

Download Protein FASTA

128 aa · TkA03G445510|TK1151|PROTEIN

MGTMWSGGQKSREEIDMALTKVKEIVSSNPVVLFSKTYCGYCQRVKKLFTELNASYRLLELDEESDGSAIQSALAELTGQTTVPNVFIGGKHVGGSDAVMEKHRSGKLVPMLTEAGAIANNSAQLSSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G445510`
TK1151 ID	TkA03G445510
OH-1004 ID	LXL04_009535
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G445510

Location Chr03:111121316-111122752 (-)

Description Similar to GRXC1: Glutaredoxin-C1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63030`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release
`At5g40370`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0618100`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009535 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0034599 cellular response to oxidative stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0015038 glutathione disulfide oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT5G40370

ath:AT5G63030

dosa:Os02g0618100

rcu:8289824

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.567

Rank 1 · TkA03G445510 · TK1151

Nucleus0.258

Rank 2 · TkA03G445510 · TK1151

Mitochondrion0.190

Rank 3 · TkA03G445510 · TK1151

Cell membrane0.148

Rank 4 · TkA03G445510 · TK1151

Endoplasmic reticulum0.126

Rank 5 · TkA03G445510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26981Thioredoxin-like_PDI5-25 aa

PF13192Thioredoxin_36-16 aa

PF07373CAMP_factor9-54 aa

PF00085Thioredoxin28-57 aa

PF26981Thioredoxin-like_PDI30-53 aa

PF13098Thioredoxin_230-63 aa

PF00462Glutaredoxin31-93 aa

PF05768Glrx-like31-62 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G445510	`PF26981`	Thioredoxin-like_PDI	5	25	0.055	14.1
TkA03G445510	`PF13192`	Thioredoxin_3	6	16	0.076	13.8
TkA03G445510	`PF07373`	CAMP_factor	9	54	0.045	13.9
TkA03G445510	`PF00085`	Thioredoxin	28	57	0.0057	17.4
TkA03G445510	`PF26981`	Thioredoxin-like_PDI	30	53	0.055	14.1
TkA03G445510	`PF13098`	Thioredoxin_2	30	63	0.11	13.5
TkA03G445510	`PF00462`	Glutaredoxin	31	93	5.6e-20	72.0
TkA03G445510	`PF05768`	Glrx-like	31	62	0.0091	17.0
TkA03G445510	`PF01323`	DSBA	31	56	0.32	11.5
TkA03G445510	`PF13899`	Thioredoxin_7	32	50	0.24	12.3
TkA03G445510	`PF13417`	GST_N_3	33	101	1.1e-05	26.3
TkA03G445510	`PF13192`	Thioredoxin_3	35	93	0.076	13.8
TkA03G445510	`PF13409`	GST_N_2	38	101	9.8e-05	23.6
TkA03G445510	`PF01323`	DSBA	73	99	0.32	11.5
TkA03G445510	`PF13417`	GST_N_3	95	123	1.1e-05	26.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L8T2`	Arabidopsis thaliana	sp\|Q8L8T2\|GRXC1_ARATH Glutaredoxin-C1	67.200%	Swiss-Prot	High
`Q9FNE2`	Arabidopsis thaliana	sp\|Q9FNE2\|GRXC2_ARATH Glutaredoxin-C2	64.000%	Swiss-Prot	High
`Q6K953`	Oryza sativa subsp. japonica	sp\|Q6K953\|GRXC4_ORYSJ Glutaredoxin-C4, chloroplastic	67.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card