LXL04_009535 | RubberDandelionOmics

Gene overview

LXL04_009535

Reference: OH-1004 Chr: Chr02 Coordinates: 128335058-128336022 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · LXL04_009535|LXL04_009535|OH1004|cDNA

ATGGGAACCATGTGGAGCGGAGGACAAAAATCCAGAGAAGAAATCGATATGGCTCTTACCAAAGTCAAGGAAATCGTCTCCTCCAACCCCGTTGTCCTCTTCAGCAAAACTTACTGTGGATACTGCCAGAGGGTGAAAAAACTCTTCACGGAGCTTAATGCATCTTACAAGCTTCTGGAATTGGACGAAGAAAGCGATGGCGGTGCAATCCAATCAGCTCTAGCAGAGTTGACCGGTCAGACGACTGTACCAAATGTGTT...

CDS

Download CDS FASTA

387 bp · LXL04_009535|LXL04_009535|OH1004|CDS

ATGGGAACCATGTGGAGCGGAGGACAAAAATCCAGAGAAGAAATCGATATGGCTCTTACCAAAGTCAAGGAAATCGTCTCCTCCAACCCCGTTGTCCTCTTCAGCAAAACTTACTGTGGATACTGCCAGAGGGTGAAAAAACTCTTCACGGAGCTTAATGCATCTTACAAGCTTCTGGAATTGGACGAAGAAAGCGATGGCGGTGCAATCCAATCAGCTCTAGCAGAGTTGACCGGTCAGACGACTGTACCAAATGTGTT...

Protein

Download Protein FASTA

128 aa · LXL04_009535|LXL04_009535|OH1004|PROTEIN

MGTMWSGGQKSREEIDMALTKVKEIVSSNPVVLFSKTYCGYCQRVKKLFTELNASYKLLELDEESDGGAIQSALAELTGQTTVPNVFIGGKHVGGSDAVMEKHRDGKLVPMLTEAGAIANNSAQLSSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009535`
TK1151 ID	TkA03G445510
OH-1004 ID	LXL04_009535
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009535

Location Chr02:128335058-128336022 (-)

Description Similar to GRXC1: Glutaredoxin-C1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63030`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release
`At5g40370`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0618100`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009535 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0034599 cellular response to oxidative stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0015038 glutathione disulfide oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT5G40370

ath:AT5G63030

dosa:Os02g0618100

rcu:8289824

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · LXL04_009535 · OH-1004

Nucleus0.250

Rank 2 · LXL04_009535 · OH-1004

Mitochondrion0.201

Rank 3 · LXL04_009535 · OH-1004

Cell membrane0.147

Rank 4 · LXL04_009535 · OH-1004

Endoplasmic reticulum0.132

Rank 5 · LXL04_009535 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00462.31Glutaredoxin31-93 aa

PF13417.13GST_N_333-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009535	`PF00462.31`	Glutaredoxin	31	93	4.5e-20	72.3
LXL04_009535	`PF13417.13`	GST_N_3	33	101	6.2e-06	27.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L8T2`	Arabidopsis thaliana	Glutaredoxin-C1	68.800%	Swiss-Prot	strong database homology
`Q9FNE2`	Arabidopsis thaliana	Glutaredoxin-C2	64.865%	Swiss-Prot	strong database homology
`Q6K953`	Oryza sativa subsp. japonica	Glutaredoxin-C4, chloroplastic	66.981%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card