TkA03G445030 | RubberDandelionOmics

Gene overview

TkA03G445030

Reference: TK1151 Chr: Chr03 Coordinates: 110935350-110938328 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2225 bp · TkA03G445030|TK1151|cDNA

AGACAATAGTACAATATGAATTAGCATTAATACCCATTTGGGTTTTGCAAACAAGTTAGACAAAGAGAGAGGCAAAAATGCTATTCCTCCATGTTATCTAGGCAATGGCCAACAACGGCTAGTGGGTTGGGGGAGGTGTAGAACACCAAGAACGCCGTTTTGGATGTGCCACGTATGTGGTGTTTCGGAGAACGGCTACCCACATCGGGTAGCTTGAGAGAAAACTGAACAAAAATACATTTTTTTTCGGAAATAAACAT...

CDS

Download CDS FASTA

1422 bp · TkA03G445030|TK1151|CDS

ATGGGACTGAATATTGTCGGGACTGTTGAGAAGGTAAATGGTAATGAACTGAGTTACACTAGTTTTGTCGAGAACTACTTCTCGAAGAACAAACCCGTCGTTTTAACGGGACTCATGGACGATTGGGGAGCTTGTAGAGATTGGGTTTTTGACGATGGAAGACCTAATCTCCAGTTTATATCTTCCACTTTCGGCAATTCCAAAGTTCAGGTAGCTGACTGTGGTAGCAGAGAGTTCACCGATCAGAAGAGGTCTGACAT...

Protein

Download Protein FASTA

473 aa · TkA03G445030|TK1151|PROTEIN

MGLNIVGTVEKVNGNELSYTSFVENYFSKNKPVVLTGLMDDWGACRDWVFDDGRPNLQFISSTFGNSKVQVADCGSREFTDQKRSDMSVSEFIAKWHDVSSTENGNPSTSKLNGNTLLYLKDWHFVKEYPEYKAYTTPLFFHDDWLNLYLDHYHMHEDPDTSQKNDDISCSDYRFVYMGANGTWTPFHADVFRSYSWSANVCGKKKWYFLSPSQHHLAFDRNMKNSVYDIFEEVNESIFPNFKKTTWLECTQDQNEIIFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G445030`
TK1151 ID	TkA03G445030
OH-1004 ID	LXL04_009521
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G445030

Location Chr03:110935350-110938328 (+)

Description Similar to jmjd4: 2-oxoglutarate and iron-dependent oxygenase JMJD4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63080`	Histone demethylase that demethylates 'Arg-3' (H4R3me) of histone H4 with a specific activity for H4R3me2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009521 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0010114 response to red light Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0017185 peptidyl-lysine hydroxylation Biological Process

GO:0018126 protein hydroxylation Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0045905 positive regulation of translational termination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT5G63080

dre:767690

gga:420400

hsa:65094

mmu:194952

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.545

Rank 1 · TkA03G445030 · TK1151

Nucleus0.524

Rank 2 · TkA03G445030 · TK1151

Mitochondrion0.076

Rank 3 · TkA03G445030 · TK1151

Cell membrane0.050

Rank 4 · TkA03G445030 · TK1151

Endoplasmic reticulum0.047

Rank 5 · TkA03G445030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13621Cupin_821-283 aa

PF08030NAD_binding_647-84 aa

PF02373JmjC176-281 aa

PF13621Cupin_8315-342 aa

PF08030NAD_binding_6345-363 aa

PF04084RecA-like_ORC2406-441 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G445030	`PF13621`	Cupin_8	21	283	8.4e-22	79.0
TkA03G445030	`PF08030`	NAD_binding_6	47	84	0.0071	17.1
TkA03G445030	`PF02373`	JmjC	176	281	3.2e-18	67.0
TkA03G445030	`PF13621`	Cupin_8	315	342	8.4e-22	79.0
TkA03G445030	`PF08030`	NAD_binding_6	345	363	0.0071	17.1
TkA03G445030	`PF04084`	RecA-like_ORC2	406	441	0.073	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67ZB6`	Arabidopsis thaliana	sp\|Q67ZB6\|JMJ20_ARATH Arginine-specific demethylase JMJ20	56.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card