TkA03G442660 | RubberDandelionOmics

Gene overview

TkA03G442660

Reference: TK1151 Chr: Chr03 Coordinates: 110309894-110316974 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2890 bp · TkA03G442660|TK1151|cDNA

CTTAGCATGGCATCCATAAATGCAAGTTCTGACCCCAACGCAACTGAAATATCATTTATCCCATTATTTCTTAAAAACATTCAAGAAAAAGAGTGATACTTGGAGACTGTAGCCATGGATGAAGAGAACCCAAGAAATGTTCTTGAGGTCCCTCTTATTCTTCCAATTTCAAGAACTGAAAAGGGTTGTGATATCAATTTAGGAAGAAGAAGATGGGTCAAGATCAAATCGAGCATTGTCACAGATTCAATTTTAGAATT...

CDS

Download CDS FASTA

1491 bp · TkA03G442660|TK1151|CDS

ATGGATGAAGAGAACCCAAGAAATGTTCTTGAGGTCCCTCTTATTCTTCCAATTTCAAGAACTGAAAAGGGTTGTGATATCAATTTAGGAAGAAGAAGATGGGTCAAGATCAAATCGAGCATTGTCACAGATTCAATTTTAGAATTGAAGCAACAATTAAAGCTAGCAGGGCCACTTTGTGTAGTCAGTCTTTTGCAATACATTTTGGAGATCATTTCTGTGATGTTCGTCGGCCATCTTGGAGAACTTTCTCTCTCTGC...

Protein

Download Protein FASTA

496 aa · TkA03G442660|TK1151|PROTEIN

MDEENPRNVLEVPLILPISRTEKGCDINLGRRRWVKIKSSIVTDSILELKQQLKLAGPLCVVSLLQYILEIISVMFVGHLGELSLSAASMATSFASVTGFSYMLGMGSALETFCGQAYGAEQYRMLGVHTQRAMVVLMLMAIPISIIWTYTTTIFTFFGQDLEISTMAGSYTRWLIPSIFPYGLLQCLFRFLQAQSNTKVLMISTGLTSLIHVLVCWIMVFKLGLGCQGAALSCAVSYWINVLILSIYIKFSPAFEKTWT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G442660`
TK1151 ID	TkA03G442660
OH-1004 ID	LXL04_009497
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	62.900
Protein coverage (%)	TK1151 88.911 / OH-1004 93.168 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G442660

Location Chr03:110309894-110316974 (-)

Description Similar to DTX16: Protein DETOXIFICATION 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52450`	Protein DETOXIFICATION 16.	No verified direct reference in this release
`At1g73700`	Protein DETOXIFICATION 17.	No verified direct reference in this release
`At2g34360`	Protein DETOXIFICATION 15.	No verified direct reference in this release
`At1g71140`	Protein DETOXIFICATION 14.	No verified direct reference in this release
`At1g15170`	Protein DETOXIFICATION 12.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009497 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0042908 xenobiotic transport Biological Process

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

GO:0042910 xenobiotic transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G15150

ath:AT1G71140

ath:AT1G73700

ath:AT2G34360

ath:AT5G52450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.440

Rank 1 · TkA03G442660 · TK1151

Lysosome / Vacuole0.273

Rank 2 · TkA03G442660 · TK1151

Endoplasmic reticulum0.122

Rank 3 · TkA03G442660 · TK1151

Cytoplasm0.077

Rank 4 · TkA03G442660 · TK1151

Golgi apparatus0.064

Rank 5 · TkA03G442660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554MatE58-218 aa

PF01554MatE279-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G442660	`PF01554`	MatE	58	218	5.7e-70	234.9
TkA03G442660	`PF01554`	MatE	279	440	5.7e-70	234.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHB6`	Arabidopsis thaliana	sp\|Q9FHB6\|DTX16_ARATH Protein DETOXIFICATION 16	57.500%	Swiss-Prot	High
`Q9C9U1`	Arabidopsis thaliana	sp\|Q9C9U1\|DTX17_ARATH Protein DETOXIFICATION 17	53.400%	Swiss-Prot	High
`F4IHU9`	Arabidopsis thaliana	sp\|F4IHU9\|DTX15_ARATH Protein DETOXIFICATION 15	54.300%	Swiss-Prot	High
`Q9C994`	Arabidopsis thaliana	sp\|Q9C994\|DTX14_ARATH Protein DETOXIFICATION 14	47.700%	Swiss-Prot	Medium
`Q8L731`	Arabidopsis thaliana	sp\|Q8L731\|DTX12_ARATH Protein DETOXIFICATION 12	42.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card