LXL04_009497 | RubberDandelionOmics

Gene overview

LXL04_009497

Reference: OH-1004 Chr: Chr02 Coordinates: 127492968-127495166 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1452 bp · LXL04_009497|LXL04_009497|OH1004|cDNA

ATGGACTCCAAACCGCTTCTCGGGTCTTCTGTTATAATCCAACACTCTAAATACATACTCGAGTTTAATGTAACGGAAATTATCGTAGAATTGAAACAGCAATTGATGTTAGCAGGACCTTTTATTCTAGTTAGCTTACTTCAGTACAGTTTTCTGTTAACGTCGATCATGTTCATCGGCCATCTTGGAGAGCTTGCACTTTCTGGTGCTTCCATGGCGACTTCATTCGCCAGTGTCACAGGCTTTTCCTTCATGATGGG...

CDS

Download CDS FASTA

1452 bp · LXL04_009497|LXL04_009497|OH1004|CDS

ATGGACTCCAAACCGCTTCTCGGGTCTTCTGTTATAATCCAACACTCTAAATACATACTCGAGTTTAATGTAACGGAAATTATCGTAGAATTGAAACAGCAATTGATGTTAGCAGGACCTTTTATTCTAGTTAGCTTACTTCAGTACAGTTTTCTGTTAACGTCGATCATGTTCATCGGCCATCTTGGAGAGCTTGCACTTTCTGGTGCTTCCATGGCGACTTCATTCGCCAGTGTCACAGGCTTTTCCTTCATGATGGG...

Protein

Download Protein FASTA

483 aa · LXL04_009497|LXL04_009497|OH1004|PROTEIN

MDSKPLLGSSVIIQHSKYILEFNVTEIIVELKQQLMLAGPFILVSLLQYSFLLTSIMFIGHLGELALSGASMATSFASVTGFSFMMGMGSALETFCGQAYGAKQYHMLGVHLQRAMAVLMLMGIPISLIWASTGEIFTYFGQDSEISEQAGNYARWLIPSIFPYGLLQCQIRFLQTQNNTKPLMISTGFASLIHVLCCWILVSKLGFGSSGAALSVAISYSINVLILGIYIRFSNTCERTWLGFSRDGVRDLSGFLALGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009497`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009497

Location Chr02:127492968-127495166 (-)

Description Similar to DTX16: Protein DETOXIFICATION 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52450`	Protein DETOXIFICATION 16.	No verified direct reference in this release
`At2g34360`	Protein DETOXIFICATION 15.	No verified direct reference in this release
`At1g73700`	Protein DETOXIFICATION 17.	No verified direct reference in this release
`At1g71140`	Protein DETOXIFICATION 14.	No verified direct reference in this release
`At1g15150`	Protein DETOXIFICATION 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009497 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0042908 xenobiotic transport Biological Process

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

GO:0042910 xenobiotic transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G15150

ath:AT1G71140

ath:AT1G73700

ath:AT2G34360

ath:AT5G52450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.406

Rank 1 · LXL04_009497 · OH-1004

Cell membrane0.286

Rank 2 · LXL04_009497 · OH-1004

Endoplasmic reticulum0.170

Rank 3 · LXL04_009497 · OH-1004

Golgi apparatus0.079

Rank 4 · LXL04_009497 · OH-1004

Cytoplasm0.071

Rank 5 · LXL04_009497 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554.24MatE40-200 aa

PF01554.24MatE324-431 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009497	`PF01554.24`	MatE	40	200	7.4e-56	189.0
LXL04_009497	`PF01554.24`	MatE	324	431	7.4e-56	189.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHB6`	Arabidopsis thaliana	Protein DETOXIFICATION 16	49.891%	Swiss-Prot	moderate database homology
`F4IHU9`	Arabidopsis thaliana	Protein DETOXIFICATION 15	47.182%	Swiss-Prot	moderate database homology
`Q9C9U1`	Arabidopsis thaliana	Protein DETOXIFICATION 17	44.915%	Swiss-Prot	moderate database homology
`Q9C994`	Arabidopsis thaliana	Protein DETOXIFICATION 14	42.888%	Swiss-Prot	moderate database homology
`Q8VYL8`	Arabidopsis thaliana	Protein DETOXIFICATION 10	37.199%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card