TkA03G442050 | RubberDandelionOmics

Gene overview

TkA03G442050

Reference: TK1151 Chr: Chr03 Coordinates: 110163633-110167118 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2711 bp · TkA03G442050|TK1151|cDNA

GTTTTTCCATGTTTTCTTTGGAAGAAAGAAAGAAATACAGGAACTATACTATTCACACCGCTCTTTATATACCCGACCCATAACTCATGCCATTTCCATAACCTCATAGCGATCGAATTCGCTCTCTCTTCGCGGCTCACGGCTACGCGTTTCGGATCAATTTCATATCTTTCAATCTAACTGGGTTTTCTTTTTCATCTTTAATAATCAATCGGAGCTATCGTCTCTTCGTTTTCGCAAGCTTTGTTTCTGTTTCTTTC...

CDS

Download CDS FASTA

2199 bp · TkA03G442050|TK1151|CDS

ATGGCTTCTTCGTCAATCGTGATCAAGGTTAAGTTCGGGGAAACACTCAGACGCTTCACTGCATCCATCAACGACAAGAAACTTGACCTTGACGTTGTTGCTTTAAGGGCAAAGATCCGTAGCTTCTTCAATTTCAACCCTGATGTTGCTTTCACTCTCACATACGTTGATGAAGATGGAGATGCTGTTACTCTTGCTGATGATGACGATCTTCATGATGTTGTCCGCCAGTCTCTGAACCCCTTAAGGCTTACTGTCAC...

Protein

Download Protein FASTA

732 aa · TkA03G442050|TK1151|PROTEIN

MASSSIVIKVKFGETLRRFTASINDKKLDLDVVALRAKIRSFFNFNPDVAFTLTYVDEDGDAVTLADDDDLHDVVRQSLNPLRLTVTLPKDNNTPTGPSGTSTPMRSVPPPPPPPPHHPSGPLSDFLKSMPEPLSNFLKSMPEPFRDQLTKLPLELASKASQSSTSGISELAEKLTAAYLNQMPNSMAVPRPSTEPESSSSKNKEKSVFVSEDVKSTDIEPPKRVDLKHPYFDYDSFPAPVEGYNGKPSVENKKDKNTTD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G442050`
TK1151 ID	TkA03G442050
OH-1004 ID	LXL04_009495
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G442050

Location Chr03:110163633-110167118 (-)

Description Similar to NBR1: Protein NBR1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24690`	Autophagic substrate degraded in the vacuole by non-selective autophagy.	Plant NBR1 is a selective autophagy substrate and a functional hybrid of the mammalian autophagic adapters NBR1 and p62/SQSTM1.2011 · DOI: 10.4161/auto.7.9.16389 NBR1-mediated selective autophagy targets insoluble ubiquitinated protein aggregates in plant stress responses.2013 · DOI: 10.1371/journal.pgen.1003196 E3 ubiquitin ligase CHIP and NBR1-mediated selective autophagy protect additively against proteotoxicity in plant stress responses.2014 · DOI: 10.1371/journal.pgen.1004116

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009495 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006914 autophagy Biological Process

GO:0015031 protein transport Biological Process

GO:0016236 macroautophagy Biological Process

GO:0032480 negative regulation of type I interferon production Biological Process

GO:0032720 negative regulation of tumor necrosis factor production Biological Process

GO:0045087 innate immune response Biological Process

GO:0050687 negative regulation of defense response to virus Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051258 protein polymerization Biological Process

GO:0071211 protein targeting to vacuole involved in autophagy Biological Process

GO:1900181 negative regulation of protein localization to nucleus Biological Process

GO:0000407 phagophore assembly site Cellular Component

KEGG gene cross-reference

ath:AT4G24690

gga:419902

pon:100174370

sot:102582603

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.539

Rank 1 · TkA03G442050 · TK1151

Nucleus0.496

Rank 2 · TkA03G442050 · TK1151

Cell membrane0.098

Rank 3 · TkA03G442050 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA03G442050 · TK1151

Lysosome / Vacuole0.036

Rank 5 · TkA03G442050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17618SL4P5-93 aa

PF00564PB16-86 aa

PF25671T4_Tape_measure157-271 aa

PF00569ZZ332-366 aa

PF16158N_BRCA1_IG431-532 aa

PF16158N_BRCA1_IG548-571 aa

PF24932UBA_NBR1_C648-687 aa

PF22562UBA_7650-662 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G442050	`PF17618`	SL4P	5	93	0.32	11.8
TkA03G442050	`PF00564`	PB1	6	86	1.9e-09	38.0
TkA03G442050	`PF25671`	T4_Tape_measure	157	271	2.7	7.5
TkA03G442050	`PF00569`	ZZ	332	366	7.3e-09	36.0
TkA03G442050	`PF16158`	N_BRCA1_IG	431	532	8.9e-31	107.4
TkA03G442050	`PF16158`	N_BRCA1_IG	548	571	8.9e-31	107.4
TkA03G442050	`PF24932`	UBA_NBR1_C	648	687	5.4e-32	110.1
TkA03G442050	`PF22562`	UBA_7	650	662	0.00065	20.3
TkA03G442050	`PF00627`	UBA	652	681	0.00013	22.5
TkA03G442050	`PF00569`	ZZ	670	677	7.3e-09	36.0
TkA03G442050	`PF24932`	UBA_NBR1_C	690	727	5.4e-32	110.1
TkA03G442050	`PF22562`	UBA_7	693	719	0.00065	20.3
TkA03G442050	`PF00627`	UBA	694	709	0.00013	22.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SB64`	Arabidopsis thaliana	sp\|Q9SB64\|NBR1_ARATH Protein NBR1 homolog	37.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card