TkA03G433040 | RubberDandelionOmics

Gene overview

TkA03G433040

Reference: TK1151 Chr: Chr03 Coordinates: 107733829-107736405 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1230 bp · TkA03G433040|TK1151|cDNA

ATGGATATCATCGCTATACTGATGCTAACTTCATTTACTTCCATCCATGGTGGTTCCACCAAATTTAACGACCAACCATTGTCAGAAATCGCAATTTATGAAACAGTTGTAGCCATCCATGAGAATGCCTCCATTAAAGCTTCACCTAATGTTCTTGGCTTAAAGGGCGAAGATACTGAATGGGTCCAAATTGAAGTTGATCATCCGGAACCCTCTCCTGATGATTGGGTAGCTGTTTTTTCACCAGCGAAATTCAATGG...

CDS

Download CDS FASTA

1230 bp · TkA03G433040|TK1151|CDS

ATGGATATCATCGCTATACTGATGCTAACTTCATTTACTTCCATCCATGGTGGTTCCACCAAATTTAACGACCAACCATTGTCAGAAATCGCAATTTATGAAACAGTTGTAGCCATCCATGAGAATGCCTCCATTAAAGCTTCACCTAATGTTCTTGGCTTAAAGGGCGAAGATACTGAATGGGTCCAAATTGAAGTTGATCATCCGGAACCCTCTCCTGATGATTGGGTAGCTGTTTTTTCACCAGCGAAATTCAATGG...

Protein

Download Protein FASTA

409 aa · TkA03G433040|TK1151|PROTEIN

MDIIAILMLTSFTSIHGGSTKFNDQPLSEIAIYETVVAIHENASIKASPNVLGLKGEDTEWVQIEVDHPEPSPDDWVAVFSPAKFNGSTCSFEDYTRIQSPYICSSPIKFMFANYTNPSYTNTGKSSLRLQIINQRADFSFALFSGGLSKPKLIAVSNTLTFSNPKAPLYPRLAHGKSWDEMTVTWSSGYNIDEAIPFVEWGMKGHDQSRAPAGTLTFTRNDMCGGAARGVGWRDPGFIHTSFLKNLWPNMAYTYRMGHI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G433040`
TK1151 ID	TkA03G433040
OH-1004 ID	LXL04_009395
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	68.100
Protein coverage (%)	TK1151 94.377 / OH-1004 28.699 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G433040

Location Chr03:107733829-107736405 (+)

Description Similar to PAP27: Probable inactive purple acid phosphatase 27

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50400`	Probable inactive purple acid phosphatase 27.	No verified direct reference in this release
`At4g24890`	Probable inactive purple acid phosphatase 24.	No verified direct reference in this release
`At1g13750`	Probable inactive purple acid phosphatase 1.	No verified direct reference in this release
`At1g13900`	Probable inactive purple acid phosphatase 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009395 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009451 RNA modification Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003993 acid phosphatase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G13750

ath:AT4G24890

ath:AT5G50390

ath:AT5G50400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.407

Rank 1 · TkA03G433040 · TK1151

Lysosome / Vacuole0.193

Rank 2 · TkA03G433040 · TK1151

Cell membrane0.132

Rank 3 · TkA03G433040 · TK1151

Cytoplasm0.111

Rank 4 · TkA03G433040 · TK1151

Endoplasmic reticulum0.097

Rank 5 · TkA03G433040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17808fn3_PAP45-164 aa

PF00149Metallophos63-77 aa

PF16656Pur_ac_phosph_N171-275 aa

PF00149Metallophos287-380 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G433040	`PF17808`	fn3_PAP	45	164	3.1e-44	150.5
TkA03G433040	`PF00149`	Metallophos	63	77	2.5e-08	35.3
TkA03G433040	`PF16656`	Pur_ac_phosph_N	171	275	1.2e-13	52.1
TkA03G433040	`PF00149`	Metallophos	287	380	2.5e-08	35.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5MAU8`	Arabidopsis thaliana	sp\|Q5MAU8\|PPA27_ARATH Probable inactive purple acid phosphatase 27	68.300%	Swiss-Prot	High
`Q8H1R2`	Arabidopsis thaliana	sp\|Q8H1R2\|PPA24_ARATH Probable inactive purple acid phosphatase 24	62.300%	Swiss-Prot	High
`Q9LMX4`	Arabidopsis thaliana	sp\|Q9LMX4\|PPA1_ARATH Probable inactive purple acid phosphatase 1	62.100%	Swiss-Prot	High
`Q9LMG7`	Arabidopsis thaliana	sp\|Q9LMG7\|PPA2_ARATH Probable inactive purple acid phosphatase 2	29.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card