TkA03G412420 | RubberDandelionOmics

Gene overview

TkA03G412420

Reference: TK1151 Chr: Chr03 Coordinates: 102597998-102600321 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2031 bp · TkA03G412420|TK1151|cDNA

GAAACCCACAACACAACTTCCAATACCACATCTAACTACCTAACCCTTACCAATTTCAGTTCCAATTCATCTCTTTCCTAAAAGTCCCATCTTTGAATAAAAATCTAGCAACCCATTTCGGAAAAAATTTGACTTCATATTAGGGCATTTTATAGTTTCTCAAATTAGAAACAAGTTTCTTCGGCTGCTCTGCTAGAAACTCTGCCCAGATGGACGAAGAAGTTATCATTAAACGAAGAAAGGATGCAGCAAGCGGGAAT...

CDS

Download CDS FASTA

1272 bp · TkA03G412420|TK1151|CDS

ATGGACGAAGAAGTTATCATTAAACGAAGAAAGGATGCAGCAAGCGGGAATTTGATCATGAGACCTGTGAATTGGATTAGAATGTTGAGCGATGAATTGAGCTGGAGATTTGTTTTAGCCGTCGTGATTGTATACGGAATCAACCAGGGTACGAGCATTGGTCTGTATCGGGTCAGTGTACAATACTACATGAAAGATGTACAGAAGTTACAACCTTCGGAATCGCAGTTTTACTTTGGGATTATTCAAATTCCATGGAT...

Protein

Download Protein FASTA

423 aa · TkA03G412420|TK1151|PROTEIN

MDEEVIIKRRKDAASGNLIMRPVNWIRMLSDELSWRFVLAVVIVYGINQGTSIGLYRVSVQYYMKDVQKLQPSESQFYFGIIQIPWIIKPLWGLMTDIVPIFRLRRRPYFIFAGLIGSIAMLVPAFTTNLSLVWAILFFMTASAGVAIADVTIDACVTENSISLPSLAGDMQSLCGISSSIGQLVGFAISGVLVHIIGPQGVFGVLSIPAGLVILVGFMLEEPLVHGYSHKRVSQKFLDAVKTMVTALKSPDVWRPSLYM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G412420`
TK1151 ID	TkA03G412420
OH-1004 ID	LXL04_009239
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.800
Protein coverage (%)	TK1151 87.470 / OH-1004 76.132 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G412420

Location Chr03:102597998-102600321 (+)

Description Similar to At5g25050: Probable folate-biopterin transporter 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25050`	Could mediate folate transport.	No verified direct reference in this release
`At1g79710`	Could mediate folate transport.	No verified direct reference in this release
`At5g25040`	Could mediate folate transport.	No verified direct reference in this release
`At5g10820`	Could mediate folate transport.	No verified direct reference in this release
`At2g32040`	Mediates folate monoglutamate transport involved in tetrahydrofolate biosynthesis.	Higher plant plastids and cyanobacteria have folate carriers related to those of trypanosomatids.2005 · DOI: 10.1074/jbc.m507432200 Identification of transport-critical residues in a folate transporter from the folate-biopterin transporter (FBT) family.2010 · DOI: 10.1074/jbc.m109.063651

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009239 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015884 folic acid transport Biological Process

GO:0015885 5-formyltetrahydrofolate transport Biological Process

GO:0051958 methotrexate transport Biological Process

GO:0098838 folate transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0008517 folic acid transmembrane transporter activity Molecular Function

GO:0015231 5-formyltetrahydrofolate transmembrane transporter activity Molecular Function

GO:0015350 methotrexate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G79710

ath:AT5G10820

ath:AT5G25040

ath:AT5G25050

syn:slr0642

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.328

Rank 1 · TkA03G412420 · TK1151

Endoplasmic reticulum0.243

Rank 2 · TkA03G412420 · TK1151

Cell membrane0.183

Rank 3 · TkA03G412420 · TK1151

Golgi apparatus0.170

Rank 4 · TkA03G412420 · TK1151

Cytoplasm0.127

Rank 5 · TkA03G412420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13000Acatn41-129 aa

PF03092BT149-348 aa

PF07690MFS_152-334 aa

PF07124Phytoreo_P8117-175 aa

PF13000Acatn128-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G412420	`PF13000`	Acatn	41	129	0.81	8.9
TkA03G412420	`PF03092`	BT1	49	348	9.1e-73	246.1
TkA03G412420	`PF07690`	MFS_1	52	334	2e-12	47.5
TkA03G412420	`PF07124`	Phytoreo_P8	117	175	0.068	12.8
TkA03G412420	`PF13000`	Acatn	128	168	0.81	8.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5FV41`	Arabidopsis thaliana	sp\|Q5FV41\|FBT2_ARATH Probable folate-biopterin transporter 2	56.500%	Swiss-Prot	High
`Q9SQN2`	Arabidopsis thaliana	sp\|Q9SQN2\|FBT3_ARATH Probable folate-biopterin transporter 3	54.700%	Swiss-Prot	High
`F4KIL8`	Arabidopsis thaliana	sp\|F4KIL8\|FBT5_ARATH Probable folate-biopterin transporter 5	51.000%	Swiss-Prot	High
`Q9LEV7`	Arabidopsis thaliana	sp\|Q9LEV7\|FBT6_ARATH Probable folate-biopterin transporter 6	44.300%	Swiss-Prot	Medium
`Q9SKZ5`	Arabidopsis thaliana	sp\|Q9SKZ5\|FBT1_ARATH Folate-biopterin transporter 1, chloroplastic	32.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card